KEGG   Methanobrevibacter sp. AbM4: Abm4_0530Help
Entry
Abm4_0530         CDS       T02687                                 

Definition
histone acetyltransferase ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
meb  Methanobrevibacter sp. AbM4
Brite
Enzymes [BR:meb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Abm4_0530
Transfer RNA biogenesis [BR:meb03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Abm4_0530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(634489..636201)
Genome map
AA seq 570 aa AA seqDB search
MTEETLDKACRIIIDNILNGQIQNRKDLEVEKRQLCRQMKLSKFMSNADILERASYEEMD
LITPILQKKPTRTLSGVAIVAVMCHPHKCPHGRCFYCPESSTAPPSYTGEEPAALRGRMF
KFHPYIQTYNRLMQLHKVGHPIDKVELIIMGGTFPSLDICYQEWFVSQCLKAMVDFGIVL
DDVEIKHHGSTRNLDLDDIDKNILKQYPPYSNGLVKPYKPNDYVILEDIQKANESSKIRC
IGMTFETRPDYCKPEHINRMLKMGVTRVELGVQTIHDDIYKRVKRGHTVADSINANRNLR
DSAIKVAMHFMPGLFQNQKEDLEMFKTIFTDPNYKPDMLKIYPVLVTKGSELYDLWLKGG
YEPYTTEEAVDLIVEIKKILPKWVRTMRIQRDIPTTLIQGGISNSNLGEFVYKRLEEENI
NCQCIRCREIGHKKTKEEYTIDDYQLFEESYDCCNGVEHFLSIEDKNEESLAGFLRLRLP
SPQTFREEITGKSALIRELHVYGNLIHIGKKSNKIGQHTGFGKQLLKRAEEIAIDNNKEE
ILIISGIGTRNYYRKFGYERKGPYMAKKLI
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggaaacattagataaagcttgtagaattattattgacaatattctaaatggt
caaatccagaatcgtaaggatttagaagttgaaaaaagacagttatgtagacagatgaaa
ctttctaaatttatgagcaatgcggatattttagaacgtgcaagctacgaggagatggat
ttaatcacaccaatacttcagaaaaaacctaccagaactttatcaggtgttgcaattgta
gcggttatgtgccatccacataaatgcccacatggaagatgtttttactgtcctgaaagt
agtacagcacctccaagttataccggtgaggaacctgctgccttacgtggaagaatgttt
aaattccatccttatattcaaacttacaatagattaatgcaacttcacaaagtaggacac
cctatagacaaggttgagcttattattatggggggtactttcccgtcattggacatctgt
tatcaggaatggtttgtctcccaatgtcttaaggcaatggttgattttggtattgttctt
gatgatgttgagattaaacatcatggaagcacaagaaatctggatttagatgacattgat
aagaatattctaaaacaatatccaccatattccaatggacttgtaaaaccatataagcca
aatgattatgtgattctagaggacattcaaaaggcaaatgaatcctccaagataagatgt
attggaatgacatttgagacaagacccgattactgcaaacccgaacacataaacagaatg
ttgaaaatgggagtgacgcgtgtcgaattaggtgttcagaccatacatgacgatatttac
aaacgtgttaaaagaggccataccgtagcagacagtattaatgcaaatagaaacctcaga
gattctgccattaaagttgcaatgcactttatgcccggactgttccagaaccagaaagag
gatcttgaaatgtttaaaaccatatttacagatccgaactataagccggatatgttaaag
atctatccggtacttgtaaccaagggtagtgaactatacgatctatggcttaagggtgga
tatgaaccatataccacagaagaggctgttgatttaatagttgaaatcaaaaagatacta
cctaaatgggtcaggaccatgagaatccagagggatattccaacaaccttaatacaggga
ggaatatccaattcaaatcttggagaatttgtatataaaagacttgaagaggagaacatt
aactgtcaatgtataagatgtagagaaataggccataaaaaaacaaaagaggagtataca
atcgacgattatcaattattcgaggaaagttacgactgctgtaatggtgtagaacatttc
ctgtccatagaagataaaaacgaggaaagtcttgcaggatttttaagactaagacttcca
tcaccgcagacattcagagaagagattaccggcaaatcagctttaatccgtgaattacat
gtctatggaaaccttatacatattggtaaaaaatcaaataagataggtcagcatacaggc
tttggaaaacagttacttaaaagggccgaggaaattgcaatagacaacaacaaagaggaa
atactgattataagtggaatcggtaccagaaactattaccgtaaatttggttatgaaaga
aaaggaccatatatggcaaaaaaactgatataa

DBGET integrated database retrieval system