KEGG   Methanobrevibacter sp. AbM4: Abm4_0825Help
Entry
Abm4_0825         CDS       T02687                                 

Gene name
pepA
Definition
glutamyl aminopeptidase PepA
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
meb  Methanobrevibacter sp. AbM4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:meb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Abm4_0825 (pepA)
Enzymes [BR:meb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Abm4_0825 (pepA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1014460..1015530)
Genome map
AA seq 356 aa AA seqDB search
MSDKKESKADKYFNMDLMKELCETNGISGFEDDIADIFERELTGVADTIERDNMGNIICT
KKGKKGKPTVMLASHMDEIGLMVRFIDDDGFLRFTKIGGINDQMLQNQTVTIHTDHGDVT
GVIGSKPPHITTAEERKKVVPFDKMFIDIGAKDKEEAESMVSVGDPIYINTIFAEYPHNC
FMGKAIDNRAGCYVVMEVLKRVNTDATVYGVGTVQEEVGLKGARTSAFKLNPDWAFALDT
TLSGDHPGIKPDEAPGKMGDGPVIVLIDAAGRGIITPKKVRDLLIKTGDENDIPYQLEVG
DGGTTDGSVISLTREGIPTGVFSVPTRYIHTPCSVASAEDIENTIELIVKAIESLA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaaaaagaatccaaagcagataaatactttaatatggatttaatgaaagag
ctatgtgaaaccaacggtatttctggttttgaagatgatattgcagatatttttgaaaga
gaattaactggtgtagcagacacaattgaaagggataatatgggaaatattatctgtacc
aaaaaaggtaaaaaaggtaaaccaactgttatgttagcttcacatatggatgaaattgga
ttaatggttcgtttcattgatgatgatggatttttaagattcacaaaaattggtggaatt
aatgatcaaatgttacaaaaccaaacagttacaattcatacagaccatggtgatgtaact
ggtgtaattggttctaaaccacctcacattacaactgctgaagaaaggaaaaaagtagtt
ccatttgataaaatgtttattgatattggagctaaagataaggaagaggcagaatcaatg
gtttccgtaggagatcctatttacattaatacaatatttgcagaatatcctcacaactgc
tttatgggaaaagctattgataaccgtgcaggatgctatgtagtaatggaagtacttaaa
agagtaaacaccgatgctacagtttatggtgttggaactgttcaagaagaagtgggtctt
aaaggtgctagaacttctgcatttaaattaaaccctgattgggcatttgctttagatacc
acattatctggagaccacccaggaattaaacctgatgaggctcctggaaaaatgggtgac
ggacctgttatagtacttatcgatgcggcaggtagaggaatcatcacccctaaaaaagta
agggatttacttattaaaactggtgatgaaaacgatataccttaccaattagaagttggt
gacggtggaactaccgatggtagtgtaatcagtcttacaagggaaggtattccaacagga
gtattctctgtaccaacaagatatatccacactccatgcagtgttgctagtgcagaggat
attgaaaacactattgaattaattgttaaagctattgagtcattagcttaa

DBGET integrated database retrieval system