KEGG   Methanobrevibacter sp. AbM4: Abm4_0825Help
Entry
Abm4_0825         CDS       T02687                                 

Gene name
pepA
Definition
(GenBank) glutamyl aminopeptidase PepA
Organism
meb  Methanobrevibacter sp. AbM4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1014460..1015530)
Genome map
AA seq 356 aa AA seqDB search
MSDKKESKADKYFNMDLMKELCETNGISGFEDDIADIFERELTGVADTIERDNMGNIICT
KKGKKGKPTVMLASHMDEIGLMVRFIDDDGFLRFTKIGGINDQMLQNQTVTIHTDHGDVT
GVIGSKPPHITTAEERKKVVPFDKMFIDIGAKDKEEAESMVSVGDPIYINTIFAEYPHNC
FMGKAIDNRAGCYVVMEVLKRVNTDATVYGVGTVQEEVGLKGARTSAFKLNPDWAFALDT
TLSGDHPGIKPDEAPGKMGDGPVIVLIDAAGRGIITPKKVRDLLIKTGDENDIPYQLEVG
DGGTTDGSVISLTREGIPTGVFSVPTRYIHTPCSVASAEDIENTIELIVKAIESLA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaaaaagaatccaaagcagataaatactttaatatggatttaatgaaagag
ctatgtgaaaccaacggtatttctggttttgaagatgatattgcagatatttttgaaaga
gaattaactggtgtagcagacacaattgaaagggataatatgggaaatattatctgtacc
aaaaaaggtaaaaaaggtaaaccaactgttatgttagcttcacatatggatgaaattgga
ttaatggttcgtttcattgatgatgatggatttttaagattcacaaaaattggtggaatt
aatgatcaaatgttacaaaaccaaacagttacaattcatacagaccatggtgatgtaact
ggtgtaattggttctaaaccacctcacattacaactgctgaagaaaggaaaaaagtagtt
ccatttgataaaatgtttattgatattggagctaaagataaggaagaggcagaatcaatg
gtttccgtaggagatcctatttacattaatacaatatttgcagaatatcctcacaactgc
tttatgggaaaagctattgataaccgtgcaggatgctatgtagtaatggaagtacttaaa
agagtaaacaccgatgctacagtttatggtgttggaactgttcaagaagaagtgggtctt
aaaggtgctagaacttctgcatttaaattaaaccctgattgggcatttgctttagatacc
acattatctggagaccacccaggaattaaacctgatgaggctcctggaaaaatgggtgac
ggacctgttatagtacttatcgatgcggcaggtagaggaatcatcacccctaaaaaagta
agggatttacttattaaaactggtgatgaaaacgatataccttaccaattagaagttggt
gacggtggaactaccgatggtagtgtaatcagtcttacaagggaaggtattccaacagga
gtattctctgtaccaacaagatatatccacactccatgcagtgttgctagtgcagaggat
attgaaaacactattgaattaattgttaaagctattgagtcattagcttaa

DBGET integrated database retrieval system