KEGG   Methanobrevibacter sp. AbM4: Abm4_1735Help
Entry
Abm4_1735         CDS       T02687                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
meb  Methanobrevibacter sp. AbM4
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:meb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Abm4_1735
Enzymes [BR:meb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Abm4_1735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1992590..1993183
Genome map
AA seq 197 aa AA seqDB search
MTDSKTLIVEYSKKLYDLGLVPGKSGNVSIKFKSDDGSDLVAITPTLVSLGDLTEDKIVV
IDLDGNILSDGKPSSEYVMHCSIYKNREDVSSIVHTHSPFATGYAHSNKKIKRYEGFGPI
KAPTNPEIKYYKPGTLELAENVGKAFKENQDNISDVLILKNHGIITVGSDIEEASNLAEF
IELTAKTQYISQTLNSL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagattcaaaaacacttattgtagaatattcaaaaaaactttatgacttaggttta
gttcctggaaaatcaggaaatgtcagtataaagtttaaatcagatgatggttcagatttg
gtagccattacaccaaccttggtttcattaggtgatctgacagaggataaaattgtagtt
attgatttagatggaaatatattgtccgatggtaagccttcatctgagtatgtaatgcat
tgttccatttacaagaaccgtgaggatgtatcaagtattgtacatacacattcaccattt
gccacaggctatgcccactccaataaaaagattaaaagatatgagggtttcggaccaatt
aaagctcctacaaatcctgaaattaaatactacaaaccgggaacattagagcttgcagag
aatgttggcaaggcatttaaagaaaatcaggataatatatcagatgtattaatcttaaaa
aaccatggaataatcactgtcggatccgatatagaggaggcatctaaccttgctgaattt
attgaattaacagctaaaacacagtacatatcccaaacattaaattcactataa

DBGET integrated database retrieval system