KEGG   Methylophaga frappieri: Q7C_1004Help
Entry
Q7C_1004          CDS       T02056                                 

Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mec  Methylophaga frappieri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Q7C_1004
Enzymes [BR:mec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Q7C_1004
Exosome [BR:mec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q7C_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1037798..1039981
Genome map
AA seq 727 aa AA seqDB search
MTNLFETKLTIEHQKIVEARHHDPFSILGFHRQSEHATVTLFLPDCESVKLAGGQEFTRI
PQSDFFVWQGAMSAISLPIKLQKTLKDGRQLESWDPYSFPPQLSDYDLHLFSEGRHWHAY
QMLGAHPTEVNNVSGVLFSVWAPNAQRVSVVGEFNGWDGRRHPMRVRGGSGVWELFIPAL
QANDLYKFEIRNHHDGSLHLKTDPYAQSCELRPGTASKVFQSEYQWHDQDWMAQRERANW
LHSPQNIYEVHLGSWRRHAENRFYSYNELADDLVDYVKQMGFSHIELLPVTEHPFDMSWG
YQTTGYYAATSRFGTPDEFRYLVDRCHQENIGVLLDWVPGHFPKDAHGLAQFDGTALYEH
ADPRLGEHQDWGTLIFNYGRSEVRNFLLSSAFFWLEEFHIDGLRVDAVASMLYLDYSRQE
GEWLPNKFGGRENLEVIDFLRDMNEILHKAHPGCIIAAEESTSYPMVSRPTDMGGLGFSM
KWNMGWMHDILEYMKQDPIHRRYHHQQLTFGLLYAFTENFVLPFSHDEVVHGKRSLRYKM
PGDEWQQFANLRLLYTFMYSYPGKKLLFMGSEFGQGSEWNSESQLEWYVLDYTPHQGLQQ
CVRDLNHLYRDVPALHYFDFDSRGFEWLDCHDHEHSILSLLRQTDHDFLIAIFNFTPVAR
NAYRVGVPESGCYEVIFNSDSAYYWGSNYETVSEVHAESQPWADRPYSISLNLPPLAGLY
LKKKRTA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacttatttgaaacaaaattgacaattgaacaccaaaaaatcgtggaagcccgt
catcatgatcccttctctattttgggttttcatcgacagagtgagcacgctaccgtcacc
ttatttttgccagattgcgaatcggtaaaactggcaggaggtcaagaatttacccgtatt
ccgcaaagcgatttttttgtctggcaaggcgcaatgagtgcgattagtctgccaatcaag
ttgcaaaaaacacttaaggacggtcgccaactggagagctgggatccctatagttttccg
ccgcaattatcagactacgatttgcacttgttttctgaaggtcgtcattggcatgcctat
cagatgttaggtgcccaccccaccgaggtaaataacgttagcggtgtcttattttctgtc
tgggcacctaatgcccaacgtgtcagtgtggttggtgaattcaatggctgggatggtcgg
cgtcatccgatgcgggttcgcggtggcagcggcgtctgggaattatttatacccgcctta
caagccaatgatttatacaagtttgaaattcgcaatcatcacgatggcagtctccatctt
aaaaccgatccatatgcccaatcttgtgagcttcgacccggtacagcgtcaaaagtcttt
caaagtgaataccagtggcatgatcaagactggatggcgcaacgtgaacgcgcaaactgg
ttacacagcccacaaaatatttatgaagtccacttaggttcctggcgccgacatgccgaa
aatcgcttttacagctataacgaactggctgatgatctggttgattacgtcaaacaaatg
ggctttagtcatattgaactactccccgtcacagagcatccatttgatatgtcatggggc
taccagacaaccggttactatgcggctacaagccgctttggcacaccagatgaattccgc
tacctggttgaccgttgccatcaagaaaacattggcgtcctgcttgattgggttccgggt
cactttccaaaagatgcacacggtctggcccagtttgatggcaccgcactatacgaacat
gcagatcctcgattaggtgaacatcaggactgggggacgttgatcttcaactatggtcgt
agtgaagtgcgtaactttttactttccagtgcttttttctggcttgaagaatttcatata
gatgggttacgtgtggatgccgttgcctccatgctatatctggattattcccgccaggag
ggcgaatggttgcccaacaagtttggtggccgtgaaaatcttgaggtaatcgattttctg
cgtgatatgaatgagattctgcataaagcccaccccggctgcattattgcggcagaagaa
tcaacctcttacccgatggtttcccggccaaccgacatgggtggccttggcttttccatg
aaatggaatatgggctggatgcacgatattctggaatatatgaagcaagatcccattcat
cgacgctatcaccatcaacagctaacatttggcctgctctacgcatttacagaaaacttc
gtcctgccattttcacatgatgaagtcgttcacggaaaacgttctctacgctataaaatg
cctggagacgaatggcagcagtttgccaacctacgcttgctgtacacctttatgtatagc
tatccgggcaaaaagttactgtttatgggatcggaatttggccaaggcagtgaatggaat
tcggaaagtcagttggaatggtatgtcctcgactacaccccacatcaaggattacaacaa
tgcgtgcgggacctaaatcatctttatcgagatgttccggcattacattactttgatttt
gattctcgaggtttcgaatggctggactgccatgatcacgagcattccatcctcagcctg
ttgcggcaaactgaccatgactttctgattgctatttttaattttacgccagttgcaaga
aatgcatatcgagttggcgtgccagaatctggctgttatgaagttattttcaactcagac
tcggcttactattggggaagcaactacgaaacggtcagcgaagtacatgctgagtcacaa
ccatgggcggaccgtccctactccatcagtcttaacttacctccacttgccgggctttat
ctgaaaaagaaacggacagcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system