KEGG   Methylophaga sp. JAM7: Q7C_114Help
Entry
Q7C_114           CDS       T02056                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mec  Methylophaga sp. JAM7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(111751..112752)
Genome map
AA seq 333 aa AA seqDB search
MRLAISMMKKHSIATTPANYAVWFEYVSGNNADLMRAMDDVLAQHGSLTDQQSKQLYEQF
FDREKDRSTLLQIRKELGNLLKQVLNVVYSGVNSSDNSHYQLQQTLQRLQPDISRQQLND
LIQEVLIETRLIASAGEAISNRLNVAVNEVEDLKKLLETSRREANIDMLTGLANRKALDD
SLTRLTQQADHNGMDLAVLLCDMDSFNALNEKHGQPVGDQVLRMVAETMQNSLKGRDLIA
RYGGEEFVILLSDTTLANAKMIAENLRAEIAGKHLRRKDTQEPLGMITVSFGVARYTAGE
GSDSLMQRVDRAVFMAKKNGRNSVCEAPPPVIF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctggccatttccatgatgaaaaagcatagtattgccacgacacctgcgaattac
gcggtatggtttgaatacgtctctggcaataatgcagatctcatgcgggcaatggatgat
gtcttggcacagcatggcagcttgacagatcaacaaagcaagcaactttacgaacagttt
tttgatcgagagaaagaccgttcgacgttgctgcaaatccgtaaagagcttggtaacctg
ctcaagcaagtgctgaatgtggtatacagcggtgttaattctagtgataacagtcattat
cagcttcaacaaaccttacagcgtttgcagcctgacatcagccggcagcaattaaatgat
ttgattcaggaagtactgatagagacgcgattaattgcttctgctggcgaagcgatcagt
aaccggctcaatgtcgcggtgaatgaagtagaagacctaaagaagctgcttgaaacaagt
cgtcgagaagcaaatatcgatatgttaaccgggctggctaatcgcaaagcattagatgat
tccttaacacgtcttacgcagcaagctgatcacaatggcatggatttggctgttttgctc
tgtgacatggattcattcaatgcacttaatgaaaagcatggccaacctgttggagatcag
gttctgcgcatggtcgccgagacgatgcaaaacagcttgaaagggcgagacctgatagct
cgatatggcggagaagaattcgttattctactcagtgatacgacactggccaacgccaaa
atgattgctgaaaacttgcgagcggagattgccggcaaacatctcagacgcaaagatacc
caagagccgttgggcatgattactgtctcattcggtgtggcccgttacactgcaggcgaa
gggtcggatagcttgatgcagcgcgtcgatcgtgccgtatttatggccaagaaaaacggg
cgtaatagtgtttgcgaggcaccaccgcccgtcattttctga

DBGET integrated database retrieval system