KEGG   Methylophaga sp. JAM7: Q7C_1217Help
Entry
Q7C_1217          CDS       T02056                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mec  Methylophaga sp. JAM7
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mec00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1243961..1244749)
Genome map
AA seq 262 aa AA seqDB search
MGIVNVTPDSFSDGGRFLAADKALEQARKLVADGAAIIDIGGESTRPGAEPVDEETEIQR
VVPAIEAITAELAVPISIDTMKPAVMQAAVEAGAAMINDVNALRAEGALAVAASLKVPVC
LMHMQGAPQTMQQNPHYTDVVQEVKDFLLEQVAACEAAGISRSNLILDPGFGFGKKATHN
LRLMKHLTAFTELGLPLLVGVSRKSIIGKMLNVTVDERLAGSLALASIAVWQGASIIRSH
DVGETVQAIQLCQHVKQVEDFD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggcattgttaacgtcacgccggattctttctctgatggtgggcgtttccttgcagca
gataaagcgcttgaacaggcacgaaaactagttgctgacggtgcagcaataatcgatatc
ggtggtgaatcaacccgtccaggtgcggaaccggttgatgaagaaactgaaatccaacga
gttgtgcctgccattgaagcgattaccgctgaattggctgtgcccatttcaattgatacg
atgaaaccggcggtgatgcaggccgcggtcgaggccggtgcggcgatgatcaatgacgtg
aatgcactccgtgcagagggagcgttggcggttgctgcttcattaaaagtaccggtttgc
ctgatgcacatgcagggggcgccgcaaaccatgcagcaaaacccgcattacacggatgtt
gtgcaagaagtgaaagattttttactggagcaggtggctgcttgtgaggcggcaggtata
tcgagatcaaatctgattttggatccgggttttggttttggcaagaaagcaacacataat
ttgagattgatgaagcatctcactgcctttacagaattaggtctgccgctgttagtcggt
gtttcacgtaaatctataattggtaaaatgctgaatgttactgtcgatgagaggctggca
ggcagtttggctttggccagcattgcggtatggcagggtgcgagtattattcgcagtcat
gatgttggtgagaccgttcaggcaattcagctttgccagcatgtaaaacaggttgaagac
tttgactga

DBGET integrated database retrieval system