KEGG   Methylophaga frappieri: Q7C_1217Help
Entry
Q7C_1217          CDS       T02056                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mec  Methylophaga frappieri
Pathway
mec00790  Folate biosynthesis
mec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Q7C_1217
Enzymes [BR:mec01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Q7C_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Sacchrp_dh_NADP CdhD
Motif
Other DBs
NCBI-ProteinID: AFJ02367
UniProt: I1YHH4
Position
complement(1243961..1244749)
Genome map
AA seq 262 aa AA seqDB search
MGIVNVTPDSFSDGGRFLAADKALEQARKLVADGAAIIDIGGESTRPGAEPVDEETEIQR
VVPAIEAITAELAVPISIDTMKPAVMQAAVEAGAAMINDVNALRAEGALAVAASLKVPVC
LMHMQGAPQTMQQNPHYTDVVQEVKDFLLEQVAACEAAGISRSNLILDPGFGFGKKATHN
LRLMKHLTAFTELGLPLLVGVSRKSIIGKMLNVTVDERLAGSLALASIAVWQGASIIRSH
DVGETVQAIQLCQHVKQVEDFD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggcattgttaacgtcacgccggattctttctctgatggtgggcgtttccttgcagca
gataaagcgcttgaacaggcacgaaaactagttgctgacggtgcagcaataatcgatatc
ggtggtgaatcaacccgtccaggtgcggaaccggttgatgaagaaactgaaatccaacga
gttgtgcctgccattgaagcgattaccgctgaattggctgtgcccatttcaattgatacg
atgaaaccggcggtgatgcaggccgcggtcgaggccggtgcggcgatgatcaatgacgtg
aatgcactccgtgcagagggagcgttggcggttgctgcttcattaaaagtaccggtttgc
ctgatgcacatgcagggggcgccgcaaaccatgcagcaaaacccgcattacacggatgtt
gtgcaagaagtgaaagattttttactggagcaggtggctgcttgtgaggcggcaggtata
tcgagatcaaatctgattttggatccgggttttggttttggcaagaaagcaacacataat
ttgagattgatgaagcatctcactgcctttacagaattaggtctgccgctgttagtcggt
gtttcacgtaaatctataattggtaaaatgctgaatgttactgtcgatgagaggctggca
ggcagtttggctttggccagcattgcggtatggcagggtgcgagtattattcgcagtcat
gatgttggtgagaccgttcaggcaattcagctttgccagcatgtaaaacaggttgaagac
tttgactga

DBGET integrated database retrieval system