KEGG   Methylophaga frappieri: Q7C_1279Help
Entry
Q7C_1279          CDS       T02056                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mec  Methylophaga frappieri
Pathway
mec00010  Glycolysis / Gluconeogenesis
mec00052  Galactose metabolism
mec00500  Starch and sucrose metabolism
mec00520  Amino sugar and nucleotide sugar metabolism
mec00521  Streptomycin biosynthesis
mec01100  Metabolic pathways
mec01110  Biosynthesis of secondary metabolites
mec01120  Microbial metabolism in diverse environments
mec01130  Biosynthesis of antibiotics
mec01200  Carbon metabolism
Module
mec_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7C_1279
   00052 Galactose metabolism
    Q7C_1279
   00500 Starch and sucrose metabolism
    Q7C_1279
   00520 Amino sugar and nucleotide sugar metabolism
    Q7C_1279
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Q7C_1279
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Q7C_1279
Enzymes [BR:mec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Q7C_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFJ02429
UniProt: I1YHN6
Position
complement(1306458..1307426)
Genome map
AA seq 322 aa AA seqDB search
MATFLAADIGGTKTILRLFDSQEQVLLQHYYVSAEFADFESLLADFFSRIESTLLPIRVA
CFAVAGPVNKTVAHVTNLPWQLDAERLRQKWPIQQVELMNDFAAVAAGIAQLTTDDLRIL
QTGDVALSAPRAVIGAGTGLGQAYMTPDANGWQVWATEGGHTDFAPADAQQQALLASLWQ
RWPHVSNERLVSGAGLQEIYAFLAKQYPLSASLDADRDAAMQISELAHQDDPLSKAAMAL
FVQLYAAQAGNLALTIMPRGGLFLAGGIVAKNHTFFETGDFIKHFQAKGRMQPIMAAIPV
YLILQQNTGLLGAAMHARQSAV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtttctggcagcagatattggcggcacaaaaacgatactgcgcttattcgat
agccaggaacaggtgttattacagcactattacgttagcgctgagtttgccgactttgaa
tcacttttggccgatttttttagtcgtatcgagtcgacgttactccccattcgggttgcc
tgttttgcggttgccgggccggttaacaaaacagttgctcacgtgaccaatttaccttgg
caactggatgcagaaagattacgtcaaaaatggccgatacagcaggttgagctgatgaat
gattttgctgcggttgcagcgggtattgcgcaattgacgacggatgatttacggattttg
cagacaggtgacgtagcgttgagtgcgcctagagccgtgatcggcgcaggaacagggtta
gggcaggcctatatgacgcctgatgcaaatggttggcaggtatgggcgacggaaggtggt
catactgactttgcgccggctgatgcgcagcaacaggcattgttggcatcattgtggcaa
cgctggccgcatgtttccaatgaaaggttagtttctggtgcggggcttcaggaaatttat
gcgtttcttgccaagcagtatccgttgtcagcgtcattggatgcagaccgggatgcggcg
atgcaaatcagtgagcttgcccatcaggatgatcccctgtcaaaagcagcaatggcctta
tttgttcagttatatgctgctcaggcaggaaatctggcgctcactattatgccgcggggt
ggcttgtttctggctggtggtattgtcgctaaaaatcacacattttttgagacaggtgat
tttattaaacattttcaggccaaaggcagaatgcaaccgataatggcagcgatcccggtt
taccttatcctgcaacagaatactggtttgttgggtgcagccatgcatgcgcggcaaagc
gcggtataa

DBGET integrated database retrieval system