KEGG   Methylophaga frappieri: Q7C_1327Help
Entry
Q7C_1327          CDS       T02056                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mec  Methylophaga frappieri
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Q7C_1327
Enzymes [BR:mec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Q7C_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1356502..1357113)
Genome map
AA seq 203 aa AA seqDB search
MSGNLFIVAAPSGAGKTSLVNALVSTQPQVRLSVSHTTRPARAGEIDGQDYHFVDMATFG
QMRDAGEFMESANVFDNFYGTSASAVQAQLLQGFDVILEIDWQGAQQVRNNFADSHSVFI
LPPSKATLEQRLRHRGQDDEATISRRMRDAEREISHYVEFDYLIVNDDFDTALHSLTAIV
VAARHQQRHQVNQYQSLLAELLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaatctgtttattgttgctgcaccgtccggtgccggaaaaaccagtctggtc
aatgccctggttagcacgcagccacaagttcggctgtcggtgtcgcatacaacgcgtcca
gcacgcgcaggtgaaattgatggacaagattatcattttgtcgatatggctaccttcggg
cagatgcgagatgccggtgaatttatggagtcagccaacgtgtttgacaatttctacggc
acgtccgcatcggcggtgcaggcgcagttacttcaaggattcgacgtcatccttgaaatt
gactggcaaggagcacagcaagttcgtaataattttgctgacagtcatagcgtctttatt
ttaccgccatcaaaagccacgctggaacaacgtttacgacatcgcggtcaagatgatgaa
gcaaccattagtcgccgcatgcgtgacgcagagcgggaaatttcgcattatgtggaattt
gattacttaattgttaatgatgattttgataccgcattgcacagcttaacggcgatcgtt
gtcgcagcccggcatcaacaacgtcatcaagtgaaccaatatcagtcgctgttagcggaa
ttactggcgtga

DBGET integrated database retrieval system