KEGG   Methylophaga sp. JAM7: Q7C_1327Help
Entry
Q7C_1327          CDS       T02056                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mec  Methylophaga sp. JAM7
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mec00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1356502..1357113)
Genome map
AA seq 203 aa AA seqDB search
MSGNLFIVAAPSGAGKTSLVNALVSTQPQVRLSVSHTTRPARAGEIDGQDYHFVDMATFG
QMRDAGEFMESANVFDNFYGTSASAVQAQLLQGFDVILEIDWQGAQQVRNNFADSHSVFI
LPPSKATLEQRLRHRGQDDEATISRRMRDAEREISHYVEFDYLIVNDDFDTALHSLTAIV
VAARHQQRHQVNQYQSLLAELLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaatctgtttattgttgctgcaccgtccggtgccggaaaaaccagtctggtc
aatgccctggttagcacgcagccacaagttcggctgtcggtgtcgcatacaacgcgtcca
gcacgcgcaggtgaaattgatggacaagattatcattttgtcgatatggctaccttcggg
cagatgcgagatgccggtgaatttatggagtcagccaacgtgtttgacaatttctacggc
acgtccgcatcggcggtgcaggcgcagttacttcaaggattcgacgtcatccttgaaatt
gactggcaaggagcacagcaagttcgtaataattttgctgacagtcatagcgtctttatt
ttaccgccatcaaaagccacgctggaacaacgtttacgacatcgcggtcaagatgatgaa
gcaaccattagtcgccgcatgcgtgacgcagagcgggaaatttcgcattatgtggaattt
gattacttaattgttaatgatgattttgataccgcattgcacagcttaacggcgatcgtt
gtcgcagcccggcatcaacaacgtcatcaagtgaaccaatatcagtcgctgttagcggaa
ttactggcgtga

DBGET integrated database retrieval system