KEGG   Methylophaga frappieri: Q7C_1340Help
Entry
Q7C_1340          CDS       T02056                                 

Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mec  Methylophaga frappieri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q7C_1340
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7C_1340
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Q7C_1340
Enzymes [BR:mec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Q7C_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1366959..1368041)
Genome map
AA seq 360 aa AA seqDB search
MQFRPRYTGLIEHYRDRLPVNDDTRLISLGEGNTPLIKLNNIPKKIGKHVDMYIKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYASRAGITAFVLIPDGKIAQG
KLAQAMMHGATVIQIKGNFDQGMQLVKDVAQHAPVTIVNSINPYRLQGQKTAAFEIVEEL
SCAPDYHCLPVGNAGNITAHWMGYSEYYEDGIVATRPKMLGFQASGSAPFMRGHMVDDPE
TVATAIRIGHPQSWDKAWKVKEESGGWFDECTDEEILAAQKLLAEMEGIFCEPASAASVA
GALRDIKNGKIPENSKVVCTLTGHGLKDPDTAIKQSTSAVVTVNADLDSVRDAILNNMGT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcaattccgaccccgttacactggtctgattgaacattatcgtgatcgtctgccggtc
aatgacgatacgcgcttgattagtcttggtgaaggcaatacaccactcattaagctcaac
aacattcccaaaaaaatcggcaaacatgtcgatatgtatattaagtacgaagggctcaat
ccaaccggatcatttaaagatcgtggtatgaccatggcggttaccaaagcggttgaagaa
ggcagtaaagccattatttgtgcatcgacgggtaatacttcagcggcggccgcagcctat
gcatcacgtgctggtatcactgcgtttgtcctgattcctgatggtaaaatcgcgcagggc
aagcttgctcaggcgatgatgcatggcgccacggtgatccagatcaaggggaactttgat
cagggtatgcaattggttaaagatgtcgctcagcatgcaccggtgactatcgttaattcg
attaacccgtatcgactacaaggtcagaaaacagccgcgtttgaaattgttgaagaatta
tcttgtgcgccagattatcactgtctgccggtcggtaatgctggcaatattaccgcgcat
tggatgggctacagcgaatattatgaagatggtattgtcgccacgcggccaaaaatgctg
ggctttcaagccagtggcagtgccccatttatgcgtggccacatggtagatgatcccgaa
acagtcgcgaccgccattcgaattggccatccgcaaagctgggacaaggcctggaaagtg
aaagaagaatcaggcggttggtttgatgagtgcaccgatgaagaaattcttgcggctcaa
aagttactagcagaaatggaaggcattttctgtgaaccggcttcggcggcttctgttgct
ggcgcattacgggatatcaagaatggcaagattccagaaaacagtaaagtggtttgtacg
ctgactggtcatggtctgaaagatcccgatacggctattaagcagagcacttctgctgtg
gtaacagtgaatgcggatctggattcggtccgtgatgcgatattgaataatatgggtacc
taa

DBGET integrated database retrieval system