KEGG   Methylophaga frappieri: Q7C_1384Help
Entry
Q7C_1384          CDS       T02056                                 

Definition
ribulose-5-phosphate 4-epimerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mec  Methylophaga frappieri
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Q7C_1384
Enzymes [BR:mec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Q7C_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1406228..1406809)
Genome map
AA seq 193 aa AA seqDB search
MSDPIVELNELKQQLVQHYRWLRQYGCNDSHSGNASLRWHDQIWITPTGCCADTLMPDDL
VCCHIDGDCGTGASLDARLHIAVYQKNESAQCVIHSHGPHAVAFSLTGKDFTPIDFEGQY
YFPVVPVIHINYTDYVTESPKKVALALAEHPIVMVKGHGLYACAETINLAYKWSCSLELS
AKTAWLAAQIASE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcctatcgttgaattaaacgaactaaaacaacaactcgtccaacattaccgc
tggctacgccagtatggctgtaatgattcgcatagtggtaatgcctcactgcgttggcat
gaccagatttggataacaccaaccggctgttgtgctgataccttaatgccggatgatctg
gtgtgttgtcatattgacggcgattgtggcactggcgcttctttagatgccagactacac
atcgcggtttaccaaaaaaatgaatctgcacaatgtgtcatacatagtcatggtccgcat
gccgtcgcttttagcctgacaggcaaggatttcaccccaatcgactttgaaggtcaatat
tattttccagtggtgccggtcattcacattaattacacagattatgtgacagaatcacct
aaaaaagtcgctttagcgttggctgaacatccgatagtcatggtaaaaggccatggtctt
tacgcttgtgcggaaacaattaatctcgcctacaagtggagctgttcattggagctgtca
gcaaaaactgcttggttggcagcgcaaatcgcgtcagagtag

DBGET integrated database retrieval system