KEGG   Methylophaga frappieri: Q7C_1399Help
Entry
Q7C_1399          CDS       T02056                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase( )
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mec  Methylophaga frappieri
Brite
Enzymes [BR:mec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Q7C_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1421425..1422081)
Genome map
AA seq 218 aa AA seqDB search
MTAESNAHRNMIWQQLRPNDVSDPAVLQTLEKINRADFVAPELAELAYADTALAIGCDQY
LLSPLQEARMLQALQLSNQDVVLEVGTGSGYFTALLASLASKVYSVEFYQALSDSALRRL
QLLRLNNIDFSVGDAVNGWPLPDRVDAVILTAAVPVVSSAFLEQIHVGGRLIAIVGEAPA
MQLQRVTRISEREWQTNVLFETVAPYLLGAEKRPEFAF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgaaagtaatgcgcatcgcaatatgatctggcagcaattgcgtcctaatgat
gtgtcagatccggcagtgttacagacactggaaaagatcaacagggcagattttgttgcg
ccggaattggcagaactggcctacgctgataccgccttagccattggctgtgatcaatat
ttgttatcgccattacaagaagccagaatgctgcaagcattacagctgagtaatcaagat
gtcgtgctggaagtcggtactggcagcggttattttacggcgctgctcgcatcacttgca
tcaaaggtttatagcgttgagttttatcaagcgctgagtgatagtgcgctgcggcgcctg
cagttgttacgattgaacaatattgatttctcagttggtgatgctgttaatggttggcca
ctgcccgatagggttgatgcggtgatcttaaccgctgcagttccagtggtatcatcggca
tttcttgagcaaatccacgttggtggtcgactcatcgccattgttggtgaagcaccagca
atgcaacttcaacgcgtgacacgtattagtgaacgtgaatggcagaccaatgtgttattt
gaaaccgtagcgccttacttactgggcgcagaaaagcgacctgagtttgcattttaa

DBGET integrated database retrieval system