KEGG   Methylophaga frappieri: Q7C_1656Help
Entry
Q7C_1656          CDS       T02056                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase
Organism
mec  Methylophaga frappieri
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1659388..1660455
Genome map
AA seq 355 aa AA seqDB search
MAKPTSFPPVYTDAFQQASENLRRTLPLINQHKTPVNPVNYAVWYEYVSGHNQALIDAID
TRLSKGETISNEINQYLYEKYVLMGMPEKLSQTNNGLRLVVDNTINYINRAESTAGDVAN
DLHKRQSILENCHDIDDIRDVLASILENTRKLTDSSLSLRQELADSTQEILKLRNELNAV
KHQARTDSLTNLNNRGQFDKELSQLCQTGQVRFSLLLIDIDYFKEINDRFGHALGDKLLQ
YLASLLHKHCDDLHIAARYGGDELAMLLLHTTAEETHAIAESIRQSCAASRLKKKDSQES
IGEVTISIGASLYQVGDTPIELIERADQALYQAKQSGRNRVQIWPTSTTAAELEQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaaccaacctctttcccgcctgtatacacagatgcctttcaacaagcgtctgaa
aatctgcgccgaaccctgccgctgattaatcagcacaaaacgccggttaatccggtgaat
tatgcggtttggtatgaatatgtctctggccataatcaggccttgattgacgccattgat
acccggttgagtaaaggtgagacgatcagcaatgagataaaccagtacctttacgaaaag
tatgttttgatgggcatgccagaaaagctgtcacaaaccaacaatggtctccgtttggta
gtggacaatacgattaattacattaatcgggccgaatccactgctggagacgtcgccaat
gacctgcacaaacggcaaagcattctagaaaattgccacgatatagacgatatccgtgat
gtgttagcaagtattttggaaaatacccgtaagttaaccgactccagtctgagccttcgt
caagaactcgccgattcaactcaagaaatactgaagttgcgtaacgagctcaatgcggtc
aaacatcaagcacgcacagacagcctgactaacctgaataatcgcggacaatttgataaa
gagctgtcacaactttgccaaactggccaggttcggttttcattattattaattgatatc
gattacttcaaagaaattaatgaccgttttggtcatgcccttggcgataagctgctgcag
tatcttgcgtcattgttacacaaacattgtgacgatctgcatattgctgcgcgctatggt
ggtgatgagttagccatgctgctattacatacgactgccgaggaaactcacgctatcgcc
gagagtattcggcaaagctgcgccgccagtcgattaaagaaaaaggatagccaggaatca
atcggtgaagtcactatctcgattggtgccagtctatatcaagtcggcgatacgcctatc
gaactcattgaacgtgccgatcaagccttatatcaggctaagcaatcgggtcgtaatcgc
gtgcaaatctggccaacatctaccaccgcggcagagcttgagcaataa

DBGET integrated database retrieval system