KEGG   Methylophaga frappieri: Q7C_1656Help
Entry
Q7C_1656          CDS       T02056                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mec  Methylophaga frappieri
Brite
Enzymes [BR:mec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Q7C_1656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1659388..1660455
Genome map
AA seq 355 aa AA seqDB search
MAKPTSFPPVYTDAFQQASENLRRTLPLINQHKTPVNPVNYAVWYEYVSGHNQALIDAID
TRLSKGETISNEINQYLYEKYVLMGMPEKLSQTNNGLRLVVDNTINYINRAESTAGDVAN
DLHKRQSILENCHDIDDIRDVLASILENTRKLTDSSLSLRQELADSTQEILKLRNELNAV
KHQARTDSLTNLNNRGQFDKELSQLCQTGQVRFSLLLIDIDYFKEINDRFGHALGDKLLQ
YLASLLHKHCDDLHIAARYGGDELAMLLLHTTAEETHAIAESIRQSCAASRLKKKDSQES
IGEVTISIGASLYQVGDTPIELIERADQALYQAKQSGRNRVQIWPTSTTAAELEQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaaccaacctctttcccgcctgtatacacagatgcctttcaacaagcgtctgaa
aatctgcgccgaaccctgccgctgattaatcagcacaaaacgccggttaatccggtgaat
tatgcggtttggtatgaatatgtctctggccataatcaggccttgattgacgccattgat
acccggttgagtaaaggtgagacgatcagcaatgagataaaccagtacctttacgaaaag
tatgttttgatgggcatgccagaaaagctgtcacaaaccaacaatggtctccgtttggta
gtggacaatacgattaattacattaatcgggccgaatccactgctggagacgtcgccaat
gacctgcacaaacggcaaagcattctagaaaattgccacgatatagacgatatccgtgat
gtgttagcaagtattttggaaaatacccgtaagttaaccgactccagtctgagccttcgt
caagaactcgccgattcaactcaagaaatactgaagttgcgtaacgagctcaatgcggtc
aaacatcaagcacgcacagacagcctgactaacctgaataatcgcggacaatttgataaa
gagctgtcacaactttgccaaactggccaggttcggttttcattattattaattgatatc
gattacttcaaagaaattaatgaccgttttggtcatgcccttggcgataagctgctgcag
tatcttgcgtcattgttacacaaacattgtgacgatctgcatattgctgcgcgctatggt
ggtgatgagttagccatgctgctattacatacgactgccgaggaaactcacgctatcgcc
gagagtattcggcaaagctgcgccgccagtcgattaaagaaaaaggatagccaggaatca
atcggtgaagtcactatctcgattggtgccagtctatatcaagtcggcgatacgcctatc
gaactcattgaacgtgccgatcaagccttatatcaggctaagcaatcgggtcgtaatcgc
gtgcaaatctggccaacatctaccaccgcggcagagcttgagcaataa

DBGET integrated database retrieval system