KEGG   Methylophaga frappieri: Q7C_2015Help
Entry
Q7C_2015          CDS       T02056                                 

Definition
FolM Alternative dihydrofolate reductase 1
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
mec  Methylophaga frappieri
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Q7C_2015
   00670 One carbon pool by folate
    Q7C_2015
Enzymes [BR:mec01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Q7C_2015
    1.5.1.-  
     Q7C_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2026981..2027697
Genome map
AA seq 238 aa AA seqDB search
MDPILVTGASRRVGLHIAQRLHADGYKVLAHYRTETDGVQSLRDAGVDLIQADFDSQSAI
LSFVQLLKTRYPNYRGIIHNASTFTPTESDLTAAASQYAAFFHVHMLAPFLINQALAEQL
RGEQDSPADIVHITDINAENPTPRFDSYGTTKAGLHNMMLAMAKKLAPKIKVNAVAPGPV
LFNVSHTPAARQEMLSETPLACEGGAEPVYLAVRSLLQNPFLTGVSIPVDGGRRLSKK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggatccgattttagttacgggcgcgagtcggcgtgtaggattacatattgcccagcgt
ctccatgctgatggttacaaggtgttagcgcattaccgcacagaaacggatggggtgcaa
tcattacgcgatgcgggtgttgatttgattcaggcggattttgatagtcaatcggcgatt
ttgagttttgttcagctgcttaaaacccggtatccaaactatcgtggcatcattcacaat
gcgtccactttcacgccaacagagtcagatctgaccgctgcggcaagtcaatatgcagct
ttttttcatgttcatatgctggcgccctttctcatcaatcaggcgcttgccgagcaatta
cgcggcgaacaggatagcccggcggatattgtgcatatcactgatattaatgccgaaaac
ccaaccccgcggtttgatagttacggcacgaccaaagcgggtttgcataacatgatgctg
gcaatggcaaaaaaattagcgcccaaaatcaaagtcaatgccgttgcgcccggccccgtc
ttgtttaatgtgtctcatacgccagcagccagacaggaaatgttatccgagaccccgctt
gcctgcgaaggtggcgccgaacctgtttatctggcggtgcgcagtttattgcaaaacccg
tttttgactggtgtcagtatcccggtcgatggtggtcggcgtttgtccaaaaaataa

DBGET integrated database retrieval system