KEGG   Methylophaga frappieri: Q7C_2098Help
Entry
Q7C_2098          CDS       T02056                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mec  Methylophaga frappieri
Pathway
mec00900  Terpenoid backbone biosynthesis
mec01100  Metabolic pathways
mec01110  Biosynthesis of secondary metabolites
mec01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q7C_2098
Enzymes [BR:mec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Q7C_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFJ03236
UniProt: I1YJZ3
Position
2103625..2104482
Genome map
AA seq 285 aa AA seqDB search
MTCCHWPAPAKLNLFLHITGRRADGYHLLQTAFQFLDYGDQLTVTVTSSPEISVTPQLSG
VANEDNLIYRAAKLLQAATKTSLGAQIALNKQLPMGGGLGGGSSNAATTLVALNRQWQCQ
LSDSALAELALKLGADVPVFVYGQAAWAEGVGEILTPITPPEAWYFVVIPNCQVSTAEIF
SDSELTRDCEPIKISRFLKGEGRNVCESVVRRRYPEVAEALDWLAQYATAKMTGTGACVF
AEFETEAQARQAWRQLPEKWQGFVAKGCNQSPLRQAISGNRDCMR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgtgttgtcattggccggctcccgccaagcttaatctgtttttgcacatcaccggg
cggcgggcagatgggtatcatttgttgcaaacggcatttcagtttctggactatggggat
cagctcactgtcactgtgaccagctcgccagagataagcgttactccacaactatcaggg
gttgctaacgaagataaccttatatatcgggcagccaagctgttacaagccgcgactaaa
acaagtttaggtgcgcagatagcgcttaacaagcagttgccgatgggcggtggtttggga
gggggcagtagcaatgctgccaccaccttggtcgcgctgaatcggcaatggcagtgtcag
ttatctgattcggcgttggcggaattggcgctgaagttaggcgcagatgtaccggttttt
gtttatggtcaggcggcatgggcagaaggggttggcgaaattctgacgccaataaccccg
ccagaagcatggtatttcgttgttataccgaattgtcaggtatctactgcggaaatattt
tccgattcggaattgacacgcgactgcgaacctatcaaaatatcgcgcttccttaagggg
gaaggcaggaatgtctgcgaatcggtagtccgccggcgttatccggaagttgccgaggca
cttgattggttggcgcaatatgccacagcgaaaatgaccggtacaggtgcctgcgttttt
gctgagtttgaaaccgaagcacaagcgcggcaggcatggcggcaattgccagaaaaatgg
caaggttttgttgccaaagggtgcaatcagtcaccactgcgacaggcaatctcaggtaac
cgagattgtatgagatga

DBGET integrated database retrieval system