KEGG   Methylophaga frappieri: Q7C_2104Help
Entry
Q7C_2104          CDS       T02056                                 

Definition
Phospholipase A1 precursor, Outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
mec  Methylophaga frappieri
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Q7C_2104
   00565 Ether lipid metabolism
    Q7C_2104
   00590 Arachidonic acid metabolism
    Q7C_2104
   00591 Linoleic acid metabolism
    Q7C_2104
   00592 alpha-Linolenic acid metabolism
    Q7C_2104
Enzymes [BR:mec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Q7C_2104
    3.1.1.32  phospholipase A1
     Q7C_2104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2108145..2109218
Genome map
AA seq 357 aa AA seqDB search
MFARGCVFGALLALPLSAFADNAMDKCILTQIGIVDDTMTIGEVRQLCAAERQLDLAEPI
NEKAADEVANVAAEPQNIEVTLEENTIATEDGSAVSRRVLLEKTQARNPFALMPHKPNYI
IFANNLSSTHETPFEQDDPNRDYNFQPWETKFQISLKMPLVRGLFNQRADLFVAYTNRSF
WQQFNKDGSAPFRDSNHEPEAWLSFGNDFELFGWKNSVIRTGISHQSNGQSGALSRSWNR
AYADFIFERGDWYLSFKPWLRIAESADNDDNPDIDEYMGNFELGAYYKLEDHSFEMILRN
NLDFGENYGAIQLGWTFPLTDRLQGYVQWFNGYGESLIDYNAHTNSIGFGIKVSDWL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccagaggttgtgttttcggagctttgttggctctgccattatcggcgttcgct
gataatgcaatggataagtgcatattgacgcaaatcggtattgtcgatgacaccatgacc
atcggtgaggtgaggcagttatgtgctgctgagcgccagctagatttggctgaaccgatt
aatgaaaaagcagcagatgaagttgccaacgttgctgctgaaccgcaaaacattgaagta
acgctggaagaaaataccattgctaccgaagatggctctgccgtatcacgtcgcgtgtta
ttggagaaaacgcaggctcgtaatccttttgcattaatgccgcacaaaccaaactacatt
atttttgccaacaatctatcctcaacacatgagacaccatttgaacaggatgatcccaac
agagactataactttcagccttgggaaaccaaattccaaatcagcttgaaaatgccgtta
gtcagaggtttatttaatcagcgtgcggatttgtttgttgcctacaccaatcgttcattc
tggcaacaattcaataaagatggttcagcgccgtttcgagactccaatcatgagccggaa
gcctggctttcattcggcaatgattttgagttatttggttggaaaaattccgtgattcgc
accggcatcagtcatcagtccaatggtcagtctggtgcattgtcccggagctggaatcgc
gcttacgcagactttatttttgagcgcggtgactggtatttatccttcaagccttggcta
cggattgcggaaagtgctgacaatgatgataacccggatattgatgagtatatgggtaac
ttcgagttgggcgcttattacaagcttgaagaccacagttttgaaatgattctgcgtaat
aacctcgattttggtgaaaattatggcgctatacagttaggctggaccttcccattaacc
gatagactccagggttatgtgcagtggtttaatggttatggtgagagtttgatcgattat
aatgcgcacactaacagtatcggttttggcatcaaggtcagtgattggctatga

DBGET integrated database retrieval system