KEGG   Methylophaga frappieri: Q7C_2172Help
Entry
Q7C_2172          CDS       T02056                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mec  Methylophaga frappieri
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q7C_2172
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Q7C_2172
Enzymes [BR:mec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Q7C_2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2165929..2167059
Genome map
AA seq 376 aa AA seqDB search
MENPHQQLVSTQRWVIKIGSALLTKPGQGLDLNRIRWLSGEIAELRRQGKDIVLVTSGSV
AAGMQQLGWRRRPHELHRLQAAASVGQMNLIHAYATACQYYGIHTAQILLTHADLSERER
HLNARSALQTLLKMGILPVVNENDAIATDEIRFGDNDTLAAMTANLIEADVLVILTDQSG
FFDSDPRLNPQARMLAASAASNPALDSMAGDSKGELGRGGMATKLRAARRAARSGATTVI
LSGKEPDNLRHLAAGNPVGTLFWPDMKPIKARQQWLVGHLIPKGKLILDDGAVNVICGQG
RSLLPVGIRAVQGDFSRGELVICCDAQGREVARGLANYSAAESIRIMGQPSQAIESLLGY
VDEPELIHRDNLVVTT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaatccgcatcaacaattggtgtcaacgcaacgctgggtgattaaaatcggcagc
gcgttgttaacgaagccaggtcaaggtctggatttaaatcgtattcgttggctgagtggt
gaaattgctgagttaagacgccaaggtaaggacattgttcttgttacctctggttctgtg
gcggccggtatgcagcagcttggttggcgacgccgaccacatgaattgcaccgccttcag
gccgcggccagtgtcggtcaaatgaatttgatccatgcttatgcaacggcatgtcaatat
tatggcatccataccgcacaaattttattaacccatgctgatttgtctgaaagagaaaga
catctcaatgcccggagcgctttacagactttgctaaagatgggcattttgcccgttgtt
aatgaaaatgatgccattgctacggatgaaattcgtttcggtgataacgatacgctggct
gcgatgacggcgaacttaattgaagcagatgtcctggttatcctgacagatcaaagtggc
ttttttgatagcgatccgcgtttgaatccgcaggcacgcatgctggctgcatcagcagcg
agcaatccggcgctggatagcatggctggggatagcaaaggtgaactgggacgtggcggc
atggcaaccaaattgcgagccgcacggcgtgcggcgcgttcgggtgcaacaaccgttatc
ttgtctggtaaagaaccggataatttacgtcatttagcggcgggtaatccggtcggtaca
ctcttctggccggatatgaaacccatcaaagccagacagcaatggttagtgggacatttg
attccaaaaggcaaactgatactggatgacggggccgtgaatgtgatttgtggccaaggc
agaagtttactgcccgtcggtatccgagctgttcaaggggatttttcccggggtgaactg
gttatttgttgtgatgcacaagggcgagaagtagcgagaggattagccaattacagtgcg
gcggaatccatcagaattatgggccagccaagccaggcgattgagtctttgttgggttat
gtcgatgagccagagttaattcatcgcgacaacttggtcgtcacgacctaa

DBGET integrated database retrieval system