KEGG   Methylophaga sp. JAM7: Q7C_2284Help
Entry
Q7C_2284          CDS       T02056                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mec  Methylophaga sp. JAM7
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7C_2284
   00030 Pentose phosphate pathway
    Q7C_2284
   00051 Fructose and mannose metabolism
    Q7C_2284
   00052 Galactose metabolism
    Q7C_2284
   00500 Starch and sucrose metabolism
    Q7C_2284
   00520 Amino sugar and nucleotide sugar metabolism
    Q7C_2284
  Nucleotide metabolism
   00230 Purine metabolism
    Q7C_2284
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Q7C_2284
Enzymes [BR:mec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Q7C_2284
    5.4.2.8  phosphomannomutase
     Q7C_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2272222..2274876
Genome map
AA seq 884 aa AA seqDB search
MSATPQLKKAFSRRFHSTGILFGVLLLLVVVWAIRQFDLDAQQSRYQQSRYLSDQLITEK
TKRAANTIQSWHQQAGKVAELSSWTAVKQYCLLDEIPLQPDDDLCLPVSFITLAALRQAD
QAGTAPVVMIQSESKGTYIELVRKAGDQYLIVALQPDLLKAMSQTWADNGYWALYQGSSN
AKPLAVSGDRQWMTQTPDQTADIPGSYWQLRFWAGEMPSPPLMSPLLWYIAGLILAIVSW
WFLVILLPPPPKKRPKRDISKPAPEVIASYEPRILTGYDRERYSATEDTDPESMQVTVDN
ENNDAAETDISTEAVSEANSDTIEYQHYDAFDSPPPEEDSRPAQTTPDVLDFDWQDGDSN
DEAPVLDEEPPPSDAMTSNHEKPAEPESELPQPTDISLMPALDVAMQNDKRVDDDMTPDR
AAKTEIDPAIFKTYDIRGIVGSQLNEDIMYRLGQVIGSEALSRGQKQIVLSRDGRHSSTA
YATAVAKGLNATGCDVIDIGAMPTPVLYFATHHLETNSGVMITGSHNPSDYNGIKIVLAG
ETLAGESIKMLRQRLAFDEIRSGSGNYLQQAVHDAYIAKVAEQISLSRKLQIVVDCGNGI
AGPIAPVLLERIGCKVTPLYCDVDGDFPNHHPNPGDPENLQALIAKVSEVGADLGLAFDG
DGDRLGVVTASGDIIWPDRLLLLFAQNVLAEYPGETILYDVKSTSLLRELITRAGGNPVM
VASGHSLIRKALQESGARLAGEMSGHLFFADRWYGFDDALYAACRLLELLAADPAGRQRT
PDQIFAAQPRRRNTPEIHIPMPDPATRQFMRRFSEKAVFAEANISDIDGIRADFHDGWGL
VRASNTVPGLTVRFEAATQSGLTRIQQLFATQMRQIKPDLDLPF
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccacgccgcagctaaaaaaagcattctcccgacgatttcattcgaccggtatt
ttgtttggtgttttgctgctgttggtggttgtctgggcgattaggcaatttgacttagat
gcccagcaatcgcgctatcagcaatcacgttacctgtctgatcagctgattacggaaaaa
acaaaacgggcggcaaatacgattcagtcctggcatcaacaagcgggaaaagtcgcagag
ttatcgtcttggacagcggtcaaacaatactgtttgttagacgagattccgcttcaacct
gatgatgatttatgtctgccggtcagttttattaccctcgcagcgttaaggcaggctgat
caggctggtactgcaccggtagtgatgatccagtccgagtcaaaaggcacttatatagag
ttggttcgcaaagcaggcgatcaatatcttatcgtggcgctgcagccagatttactaaaa
gcgatgtcacaaacctgggcagacaacgggtattgggcactgtatcaaggaagcagtaat
gcgaagccactggcagtcagtggtgatcgccaatggatgacgcagacgcccgaccaaacg
gcagatattccgggcagttattggcagttacgtttctgggctggagaaatgccatcaccg
ccattaatgtcgcctttgttgtggtatatcgctggattaatcctagcgatagtgagctgg
tggtttctcgtgattttattgcctccaccgcccaagaagcgacctaagcgcgatattagt
aaacccgctcccgaagtgattgcttcttatgagccgcgaattttgacgggttatgatcgt
gaacgttattcagccactgaagatactgatccagagtcgatgcaggtcaccgttgataat
gagaataatgatgctgcagagactgacatatcaacagaggcggtgtcagaagcgaatagc
gatacaatcgaataccagcattatgatgcctttgatagtccgccgccagaagaagacagt
cgaccggcgcagacaacaccagatgtattggattttgattggcaggatggcgactcaaat
gatgaggcgcccgtgcttgacgaggaaccaccaccctctgacgccatgacgtcaaatcac
gagaagcctgctgagccagaatccgaattgccccagccaaccgatatttctttaatgcct
gctctcgatgtagccatgcaaaatgataaacgcgttgatgatgatatgacgccagatcgg
gcagcgaaaacggaaattgacccggctattttcaaaacatacgacatacgcggcattgtt
ggcagccaattgaacgaagacattatgtatcgtttgggtcaagtgattggcagtgaggcg
ttgagccgagggcaaaaacagattgttctgtcacgtgatgggcgacatagcagtactgcc
tatgctactgccgtggcgaaaggcttgaatgcaacaggctgtgacgtcattgatattggt
gccatgccgaccccggttttgtattttgcaacacatcacttagaaaccaattccggcgtg
atgatcaccggcagtcataatccgtctgattacaatggcatcaaaattgttttagctggt
gaaacattggccggtgagtcgataaaaatgttacggcagcggctggcctttgatgaaatc
cgtagcggttctggtaattatcttcaacaagcggtccatgatgcctatattgccaaagtg
gctgaacagattagcttatcccggaaattgcagatagtcgtcgactgtggcaacgggatt
gctgggcccatcgcgccagttttattggagcgaattggctgcaaggtcacgccactttac
tgtgatgtcgatggcgattttccgaatcatcatcccaatcccggtgatccagaaaatctt
caggcattaattgcgaaagtcagtgaggttggcgctgatcttgggctggcttttgatggc
gatggcgatcgactgggggtggtcactgccagcggcgacattatctggccggataggctg
ttactgctgtttgctcagaatgtattggctgaatatcccggcgaaaccattctatatgat
gtgaaaagtaccagtctgctaagagagctcatcacacgcgccggcggcaatccagtgatg
gtggcatctggccactccctgatacgcaaagcgctgcaagaaagtggtgccagactggcc
ggggagatgagtggccatttgttttttgcggatcgctggtatggctttgatgatgcttta
tacgcggcctgtcgcctgctagaattactggcggctgatccggcgggacggcagcgtacg
ccagatcaaatcttcgcggcacagcctcggcgcagaaacaccccggaaatacatattccc
atgccggatccggcgacgcgccaattcatgcgtcggtttagcgaaaaggccgtcttcgct
gaggcaaatatcagtgatattgatggcatcagagcagattttcatgatggttgggggctg
gtcagggcgtccaatacggtgccggggctgaccgtgcgttttgaagcggcaacgcaatca
ggactcacgcgaatacaacagttatttgccacccagatgcggcagattaaacccgatttg
gatttgcctttttaa

DBGET integrated database retrieval system