KEGG   Methylophaga sp. JAM7: Q7C_2448Help
Entry
Q7C_2448          CDS       T02056                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mec  Methylophaga sp. JAM7
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mec00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2437730..2438218
Genome map
AA seq 162 aa AA seqDB search
MRVYIGLGSNLADPEQQIRQALRNLKALPKTQYIAASSLYRSPPMGPADQPDYLNAVAAV
ETDLSPLDLLQALQQIEKQHGRERLRHWGERTLDLDILLYDQRQIQEPLLTIPHPGLTTR
AFVVRPLHEIAGDVLIPGHANLGQYVAALADAHCEKLKDGKL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtatatattggtcttggcagtaatctagcagatcccgaacaacagattcgacag
gcactacgcaacctgaaagcattaccaaaaacgcaatacatcgctgcctccagtttgtat
cgcagtccaccgatgggaccggcggatcaacccgattatcttaatgcggttgctgcggtt
gaaaccgacttatcaccattagacttgttgcaggcattacaacaaattgaaaaacagcat
gggcgtgagcgccttcgccattggggggaacgaacgctggatctagacatcttgctgtat
gatcaaaggcagattcaggagcccttactcactatcccgcatccgggactgacgacgcgg
gcttttgtggtcaggccattacatgaaattgcgggtgatgttctgatccccggccatgca
aacttaggccaatatgtagcggcattagctgatgcccactgtgaaaagcttaaagacggt
aaattatga

DBGET integrated database retrieval system