KEGG   Methylophaga frappieri: Q7C_2526Help
Entry
Q7C_2526          CDS       T02056                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mec  Methylophaga frappieri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q7C_2526
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7C_2526
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q7C_2526
Enzymes [BR:mec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Q7C_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2515478..2516698
Genome map
AA seq 406 aa AA seqDB search
MAENLSKDYYRHYPDSNGHFGPYGGRFVGETLMGAIAELDASYQQYRLDPDFLAEMDRDL
ADYVGRPSPIYLAENWTQKLGGAQIFLKREDLNHTGAHKVNNTIGQALLAKRMGKTRIIA
ETGAGQHGVASATVAARLGLECVVYMGAEDVERQAQNVYRMKLLGATVVPVTSGSKTLKD
ALNEALRDWVTNVDTTFYIIGTVAGPHPYPAMVRDFQSVIGREAREQMLTRTGKLPDALV
ACIGGGSNAIGLFHPFIEDDAVAMYGVEGAGQGIETGKHAAPLCAGTPGILHGNRTYLMQ
DSAGEIIETHSISAGLDYPGVGPEHAWLKDIGRANYVSVTDEEALTAFHELTRSEGIIPA
LETSHALAYASKLAPTMRPDQSILINVSGRGDKDMHTVAAMAGLSF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatttaagtaaagattattatcgtcactatccggatagcaatggtcatttt
ggcccttatggtggtcggtttgtcggtgaaacgttgatgggcgcgattgcagagcttgat
gcatcgtatcagcagtatcgtcttgatccggattttttagcagaaatggatcgagacctg
gcagactatgttggccgtccatcacctatctatctggcagagaactggacccaaaaattg
ggtggcgctcaaatctttttgaaacgagaagatctgaatcacactggggcacataaagtg
aataatacgattggtcaggcattactggctaaacgtatgggcaaaacccggattattgca
gaaactggcgccgggcaacatggtgttgctagcgccacagtggcagcaaggttagggctt
gaatgtgttgtctacatgggcgcggaagacgttgagcgtcaggcacaaaatgtgtatcga
atgaagttgctgggggctacggttgttccggtcacttccggttctaaaacattaaaagac
gccctgaatgaagcattgcgtgattgggtgaccaatgttgatacgactttttacatcatt
ggcacggtagccggcccccatccttacccggccatggtaagagactttcagtcggtgatt
gggcgtgaagcccgagaacaaatgttaacgcgcacaggaaaattgccagatgcattagtt
gcttgtatcggcggtggttcaaacgccatcggtctattccatccattcattgaagacgat
gcggtcgccatgtatggtgttgagggggctggacagggtattgaaaccggtaaacatgct
gcgccattatgtgccggaacaccaggtattttgcatggtaaccggacgtacctaatgcaa
gattcggcaggtgaaattattgaaacgcattcgatttcagccggcttggattatccaggt
gttggaccagagcacgcttggttgaaagatattggtcgagcaaattacgtctctgtaacc
gatgaagaggccttgacagcgtttcacgagttgacgcgttcagaaggcataatcccggct
ttggaaaccagccacgcgcttgcctatgccagtaaactggcaccaacaatgcgccctgac
caaagtattctgattaatgtttcaggtcgaggtgataaagacatgcataccgtcgcggcg
atggccggtctaagcttttga

DBGET integrated database retrieval system