KEGG   Methylophaga frappieri: Q7C_2527Help
Entry
Q7C_2527          CDS       T02056                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mec  Methylophaga frappieri
Pathway
mec00260  Glycine, serine and threonine metabolism
mec00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mec01100  Metabolic pathways
mec01110  Biosynthesis of secondary metabolites
mec01130  Biosynthesis of antibiotics
mec01230  Biosynthesis of amino acids
Module
mec_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7C_2527
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q7C_2527
Enzymes [BR:mec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Q7C_2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB hGDE_N PI-PLC-X
Motif
Other DBs
NCBI-ProteinID: AFJ03648
UniProt: I1YL55
Position
2516707..2517528
Genome map
AA seq 273 aa AA seqDB search
MSRINQCFKDLKANGQTALIPYVTAGDPEPWVTVPLLHALVDAGADIIELGVPFSDPSSD
GPVIQKACERALQNDVSLNHVLEMVKQFRDKNQTTPIVLMGYANPIEAYGYEAFAEKASV
VGVDGVLTVDMPPEESDLFREQLEKHEIDTIFLVAPTTSEQRMKLIAQHARGFIYYVSIK
GVTGTAALNVDEVSAKLSVLRNVTALPLGVGFGIRDGKSAAAVSEVADAVVVGSTLVRCI
EEHANRPQELPAAVAAMLAEMRHAINARDLASA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaattaatcaatgttttaaagatttaaaagccaacggccagacggcgctcatt
ccctatgtgacagcaggcgacccggaaccttgggtaacagtgccactgctacatgcactc
gtcgatgccggggcggatattattgaactaggtgtaccgttttctgacccaagctctgac
gggcctgtcattcaaaaagcgtgtgaacgcgccttgcaaaacgatgtgtctttgaatcat
gtgttggagatggtgaaacagtttcgggataaaaaccaaacaactccgattgtcttgatg
ggatatgccaatccgatcgaagcctatggctatgaagcttttgctgaaaaagccagtgtg
gtcggggtggacggggtattaactgtcgatatgccgccagaagaatcagacctttttcgt
gagcaattagaaaaacatgagattgacaccatctttctcgtggcacctacaacatcggaa
caacgtatgaaattaatcgctcagcatgcgcgtggtttcatttactatgtttctattaaa
ggcgtcaccggcacagcggctttgaatgttgatgaggtatcggcgaaattaagtgtgtta
cgcaatgtgaccgcattaccattgggcgtaggttttggcatccgtgatggtaaatctgcc
gcggcagtttccgaagtagccgatgcagtggttgttggcagtacgctggtgcgttgtatt
gaggagcatgccaatcggccgcaggaacttcctgccgctgtagcagccatgcttgctgaa
atgcggcatgcgattaatgcccgtgatttggctagcgcctga

DBGET integrated database retrieval system