KEGG   Methylophaga frappieri: Q7C_2527Help
Entry
Q7C_2527          CDS       T02056                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mec  Methylophaga frappieri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q7C_2527
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7C_2527
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q7C_2527
Enzymes [BR:mec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Q7C_2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2516707..2517528
Genome map
AA seq 273 aa AA seqDB search
MSRINQCFKDLKANGQTALIPYVTAGDPEPWVTVPLLHALVDAGADIIELGVPFSDPSSD
GPVIQKACERALQNDVSLNHVLEMVKQFRDKNQTTPIVLMGYANPIEAYGYEAFAEKASV
VGVDGVLTVDMPPEESDLFREQLEKHEIDTIFLVAPTTSEQRMKLIAQHARGFIYYVSIK
GVTGTAALNVDEVSAKLSVLRNVTALPLGVGFGIRDGKSAAAVSEVADAVVVGSTLVRCI
EEHANRPQELPAAVAAMLAEMRHAINARDLASA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaattaatcaatgttttaaagatttaaaagccaacggccagacggcgctcatt
ccctatgtgacagcaggcgacccggaaccttgggtaacagtgccactgctacatgcactc
gtcgatgccggggcggatattattgaactaggtgtaccgttttctgacccaagctctgac
gggcctgtcattcaaaaagcgtgtgaacgcgccttgcaaaacgatgtgtctttgaatcat
gtgttggagatggtgaaacagtttcgggataaaaaccaaacaactccgattgtcttgatg
ggatatgccaatccgatcgaagcctatggctatgaagcttttgctgaaaaagccagtgtg
gtcggggtggacggggtattaactgtcgatatgccgccagaagaatcagacctttttcgt
gagcaattagaaaaacatgagattgacaccatctttctcgtggcacctacaacatcggaa
caacgtatgaaattaatcgctcagcatgcgcgtggtttcatttactatgtttctattaaa
ggcgtcaccggcacagcggctttgaatgttgatgaggtatcggcgaaattaagtgtgtta
cgcaatgtgaccgcattaccattgggcgtaggttttggcatccgtgatggtaaatctgcc
gcggcagtttccgaagtagccgatgcagtggttgttggcagtacgctggtgcgttgtatt
gaggagcatgccaatcggccgcaggaacttcctgccgctgtagcagccatgcttgctgaa
atgcggcatgcgattaatgcccgtgatttggctagcgcctga

DBGET integrated database retrieval system