KEGG   Methylophaga sp. JAM7: Q7C_2546Help
Entry
Q7C_2546          CDS       T02056                                 

Definition
Arylesterase precursor (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mec  Methylophaga sp. JAM7
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mec01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2536160..2536789)
Genome map
AA seq 209 aa AA seqDB search
MVQSLKKFVALLFFTSAMLIAQTNAAASEKTLLVMGDSLSAYYGMSKKAGWVNLLRDRLQ
QHDTDWQVINASISGETTDGGQRRLPDLLAKHQPQIVIIALGANDGLRGFPPPQIQSRLA
DMIRQSQSSAGVILLGIELPPNYGPVYTQAFRQVYQDLSDTYQIGLLPFMLDGIYDQPGM
MQSDGLHPSDKAQPLILDLVWPLVSPLIN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggtccaatccctgaaaaagttcgttgctttactcttttttacatcggcgatgctgatt
gctcagacaaatgcggcagcgtcagaaaaaacgctgttagtcatgggcgatagtttgagc
gcctattacggcatgtctaaaaaggccggttgggtcaacttgctacgtgaccgtctgcaa
cagcacgatactgactggcaggttattaatgccagcatcagtggagaaacgactgatggc
gggcaacgtcgcctaccggatttactggccaaacatcaaccacaaattgtcatcatcgca
ttaggcgcaaatgatggtttacgcggttttccgccgccgcaaattcaaagccgactggct
gatatgatccgtcaatctcaaagctcggctggagtgatattgctcggtattgaactgcca
ccaaactatggccccgtttacacacaagcttttcgccaggtctatcaggacttgtcggat
acttaccaaatcggattgctgccttttatgcttgatggcatttatgaccagcccggcatg
atgcaatctgacggtttgcatcccagtgataaagcacaaccgcttatcctcgatctggtc
tggccgttagtctcgccactgattaattag

DBGET integrated database retrieval system