KEGG   Methylophaga frappieri: Q7C_2657Help
Entry
Q7C_2657          CDS       T02056                                 

Definition
DNA polymerase III psi subunit
Organism
mec  Methylophaga frappieri
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2654630..2655046
Genome map
AA seq 138 aa AA seqDB search
MTLTTLQRQVLREMGIPAWQQRGQAAAQAMSTKQLVIQAPYLILLTTPLSAMAQRLLVNI
LTAVNIGDANTQVEVEQTFSELSDPQSQLHHVLYFSAQVPASLLTDTGKLIHLPDLEHVI
HQPAQKAEIWSLLQPLCQ
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacactgacgacgttgcagcgtcaagttctacgcgagatggggatccctgcctggcag
caacgagggcaggctgctgcgcaggcgatgtcgacaaaacagctggttattcaagcgcct
tatctgattttgttgacaaccccgttatctgctatggcgcaacgtttgttggtaaacata
ttaacggcggtcaatatcggtgatgccaacacgcaagttgaagtagaacagacattttct
gagctatccgatccgcaaagtcaacttcatcacgtgctctatttttcggcgcaggtgcca
gcttcattgttgactgataccggcaagctgattcacctgccagacttggagcatgtcata
catcagccggcccaaaaagcagaaatctggtcgttattacaaccactatgtcagtaa

DBGET integrated database retrieval system