KEGG   Methylophaga sp. JAM7: Q7C_404Help
Entry
Q7C_404           CDS       T02056                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mec  Methylophaga sp. JAM7
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mec00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
425975..427726
Genome map
AA seq 583 aa AA seqDB search
MNVAEIPPLLQICRQHLNTVYSGILEESERHQLADDLLEIMRLTADCPLTPADQNKWQAD
DIAVITYGNSILAEGEPPLQTLKRFADDYLKSSTNTLHILPFFPFCSDDGFAVQDFTAVN
PALGDWNDIQELAKAWRLMADLVINHASTESQWFQNFIAGSGEGHDYFYTVSADQPGLDA
VVRPRVSPLLRPTETANGLQQVWCTFSHTQADLDFRRPSVLKTFVRIIRFYLDQGIRLFR
LDAVAFLWKQAGTNCLNLPETHEIVRLLRLLTEQAQPDTVIITETNIPNRENLSYFGNGN
EAHWIYNFSLPPLLLNTLMTGECNYLRQWLMSMPPARHGTTYFNFIASHDGIGLRPAEGL
LTDAELAALISTMQSFGGEVSWRATANGIKKPYEINIALFDAMQGTLKGPDTWQIPRFIC
AHGIMLALEGIPAFYLHSLLATSNDYQRVEDKGHARAINRHQWQDTQLRDYLDSPENVHA
QVYRQLTRLIQLRRKQPAFHPNATQYTLQLGSHLFGFWRQSLCRQQSIFCVFNITDTTQS
LAVHDLNLVITDSWRDLVSGQVLANQQESIPLAPYQMLWLSNH
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgccgaaattccgccactcctccagatttgtcgacaacacctcaatacggtt
tacagtggtattttagaagagtccgaacgtcatcaattagccgatgacttactggagatc
atgcggctgacggcagattgcccgctcacaccagccgatcaaaacaagtggcaagctgat
gacatcgccgtcatcacctacggcaacagtattttggccgaaggtgaaccgccgctgcaa
accctaaaacggtttgccgacgactacttaaaatccagcacaaatacgctgcatatcctg
cctttctttccattttgtagcgatgacggtttcgccgttcaggattttaccgctgtaaac
ccagccttgggagactggaacgatattcaagaacttgccaaggcatggcgattaatggcc
gatctggtcattaatcacgcctcaactgaaagccaatggtttcaaaactttattgctggc
agcggtgaaggtcatgactatttttatactgtttcggcagatcaaccgggcctggatgcg
gtggtgcgacctcgtgtcagtccgttgttaaggccgaccgaaacagctaacggtctgcaa
caggtctggtgtacgttcagtcatacgcaagctgatttggattttcggcggccatcagta
ctgaaaacctttgtccgcatcatacgattttatctcgatcaaggtattcgtctgttccga
ctggatgcggtcgcatttttgtggaaacaggccggtactaattgtctcaatttgccagaa
acccacgaaatcgttcgattattgcgtctgctgacagagcaagcacaacccgataccgtg
atcatcacggaaaccaatatccctaatcgtgaaaatctcagctattttggtaatggcaat
gaagctcattggatatacaacttttctctgccgccactcttgttgaatacgctaatgacg
ggcgagtgtaattaccttcgtcagtggttgatgagtatgccgcctgcccgtcatgggaca
acctattttaattttattgcttctcatgatggtattggtttacgaccggctgaggggtta
ctcactgatgcggagcttgcagccttaatcagcaccatgcaaagttttggtggcgaagtt
tcttggcgcgcaacggccaatggcatcaaaaaaccttatgaaattaatatcgctttattt
gatgcgatgcaagggacgctgaaagggcctgacacatggcaaatcccccgctttatatgc
gctcacggcatcatgctcgctttagaaggtattcccgctttctatttacacagtttatta
gccacaagtaacgattatcagcgcgttgaagataaaggccatgcacgtgcaattaatcga
catcaatggcaggacactcaattaagagactatcttgatagccctgaaaatgtgcatgca
caggtatatcggcaattaaccagactgattcaactgcgccgaaaacaacccgcctttcat
ccgaatgcaacgcagtatacgttgcaacttggcagtcacttattcggtttctggcgtcaa
agcctctgccgccagcagagtattttttgtgtgtttaatatcaccgataccactcagtcc
ttagcggtacatgatctcaatctggtgattactgacagctggcgtgatctggtcagcggt
caagtccttgccaatcagcaagaatcaattccactcgccccctatcaaatgctctggcta
agcaatcactag

DBGET integrated database retrieval system