KEGG   Methylophaga frappieri: Q7C_405Help
Entry
Q7C_405           CDS       T02056                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mec  Methylophaga frappieri
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Q7C_405
   00052 Galactose metabolism
    Q7C_405
   00500 Starch and sucrose metabolism
    Q7C_405
   00520 Amino sugar and nucleotide sugar metabolism
    Q7C_405
Enzymes [BR:mec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Q7C_405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
427797..428648
Genome map
AA seq 283 aa AA seqDB search
MTKTVKIRKCLFPVAGYGTRFLPATKAMPKEMLPIVNKPLIQYGVEEAMEADLSQMGFIT
GRGKRAIADHFDTSYELEHQIRGTSKEKHLEDIRHVMDTCDFMFIRQREMLGLGHAILSG
EPMIGPEDFAVILADDLCAPPTDGSERALSQLVDLYAKQGCTVIAIEEVPPENTGSYGVI
SGEEIEPGVFRVTDMVEKPKPEDAPSNLAIIGRYVFTNDIFDYIRKTPPGANGEVQITDA
LKVMAQEKPVLALKFKGQRFDCGSIGGFVQATNYYYQTDYLDK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacggtaaaaatccgcaaatgtctcttcccggttgccggttacggtacccgg
tttctacctgcgaccaaggccatgccgaaagaaatgttgcctatcgtgaataaacccttg
attcaatatggtgttgaagaagccatggaagctgatttatcgcagatgggttttattaca
ggacgcggtaagcgggctatcgcagaccattttgataccagctatgaattagagcatcag
attcgcggcaccagcaaagaaaagcaccttgaagatatacgtcatgtcatggatacctgt
gactttatgtttattcgccagcgggaaatgcttggacttggccatgccattttaagtggt
gagcccatgatcggccctgaagattttgccgttattttggctgatgatctctgtgcaccg
ccgacggatggcagcgaacgtgcactcagccaattagtcgacctctatgcaaaacagggc
tgtaccgttatcgccattgaggaagtgccgccggaaaatacggggagttatggtgttatt
tccggtgaagaaattgaaccgggggtgtttcgtgtcaccgatatggtggaaaaacccaaa
cccgaagatgcgccgagcaatttggccatcatcggacgctatgtgtttacaaatgatatc
tttgattacattcggaagaccccgccgggcgctaacggcgaagtccagattaccgatgcc
ttgaaagtcatggctcaagaaaaacctgtgttggcgttgaagtttaagggacagcgattt
gactgtggcagtattggcggttttgttcaagccaccaattattattatcaaaccgattat
ctggataagtaa

DBGET integrated database retrieval system