KEGG   Methylophaga sp. JAM7: Q7C_530Help
Entry
Q7C_530           CDS       T02056                                 

Definition
Thiol:disulfide involved in conjugative transfer
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mec  Methylophaga sp. JAM7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(571465..572157)
Genome map
AA seq 230 aa AA seqDB search
MRKLSPIILALALSPLVQAEPVSEVSPVGKIDGMVSLPVTGMKAVESNGRIVFMSDSGRF
VIDGTLYDAWSKKPLTSLEEIREAGNTLDLSRLGLKMDDLNPLTLGEGKKKVVVFVDPRC
PHCHELLKQALPLTKEYTFQILPVPVLGPDSERQVRQLGCARDKKAATDALLNGRIGNLE
QDDACDLEPMQRTLVTAQILGIQGVPFIVANDGRISRGRPYDLSAWLEGR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaactatctccaatcattctagcgcttgcgctttctcctttggttcaagctgaa
cctgtgtctgaagtgtcgcccgttggcaaaattgacggcatggtttctttgccggtcacg
ggtatgaaagcggtcgaaagcaatggccgtattgttttcatgtcagacagtggccggttc
gtcattgatggcacgctctatgatgcctggtcgaaaaagccgcttactagccttgaagaa
attcgagaagcgggaaacacgctggacttaagtcgtcttggcttaaaaatggatgatttg
aatccactgacgctgggtgaaggcaaaaagaaagtggtggtctttgttgacccacgatgc
ccgcattgccatgagcttttgaaacaagccttaccgttaaccaaagaatacaccttccaa
attctccctgtgccagtgcttggtcctgattcagagcgtcaggttcgccagcttggctgt
gcgcgtgacaagaaagcggccaccgatgcattgctgaatggccggattggtaacctagaa
caggatgatgcctgcgacctagaaccaatgcagcgtaccttggttacagctcaaatcctg
ggcattcaaggtgtgcctttcatcgtcgccaatgatggtcgcatcagccgaggccgtcct
tatgacctttctgcttggttggaggggcggtaa

DBGET integrated database retrieval system