KEGG   Methylophaga frappieri: Q7C_625Help
Entry
Q7C_625           CDS       T02056                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mec  Methylophaga frappieri
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mec00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Q7C_625
DNA repair and recombination proteins [BR:mec03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Q7C_625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
681429..682028
Genome map
AA seq 199 aa AA seqDB search
MASLGPNIDELMQALRCLPGVGPKSAQRMTFQLLERNRDGAERLMLSLQAALQNVRHCQR
CRILSETELCSRCSDPDRRQDQLCIVEMPSDVLAIEQATAYQGQYFVLNGHLSPLDGIGP
ETLGIPTLIRWLDSQETEEIILATNPTVEGEATAHYISELARARQIRVTRLAHGIPLGGE
LEYVDSTTLSHAFAGRGTV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccagtctcggtcccaatattgatgaattgatgcaggcattacgctgcctgcccggc
gtgggtcccaagtcagcacaacgcatgactttccagttattggagcgcaatcgggacggg
gcggaacggctgatgttgtctttacaggcggcgttacaaaacgtgcgccactgtcaacgc
tgccgtattttgtcagaaacagaattatgtagccgttgcagcgatcctgatcgtcgtcag
gatcagttatgcattgttgagatgccaagtgatgttctggctattgagcaggcgacggct
tatcagggccaatactttgtcttgaatggacatctttcgccactcgatggcattggcccc
gaaacactcggcattccaacattaatccgctggctggatagccaagaaactgaagaaata
attctagcaacaaatcccactgttgaaggcgaagccacggcgcactatatttcagagctg
gcgcgtgctagacaaattcgtgttacccgattagcacatggaatcccgcttgggggtgag
ttagagtatgttgatagcactaccttatcgcatgctttcgccggccgaggcacagtctga

DBGET integrated database retrieval system