KEGG   Methylophaga sp. JAM7: Q7C_625Help
Entry
Q7C_625           CDS       T02056                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mec  Methylophaga sp. JAM7
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mec03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
681429..682028
Genome map
AA seq 199 aa AA seqDB search
MASLGPNIDELMQALRCLPGVGPKSAQRMTFQLLERNRDGAERLMLSLQAALQNVRHCQR
CRILSETELCSRCSDPDRRQDQLCIVEMPSDVLAIEQATAYQGQYFVLNGHLSPLDGIGP
ETLGIPTLIRWLDSQETEEIILATNPTVEGEATAHYISELARARQIRVTRLAHGIPLGGE
LEYVDSTTLSHAFAGRGTV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccagtctcggtcccaatattgatgaattgatgcaggcattacgctgcctgcccggc
gtgggtcccaagtcagcacaacgcatgactttccagttattggagcgcaatcgggacggg
gcggaacggctgatgttgtctttacaggcggcgttacaaaacgtgcgccactgtcaacgc
tgccgtattttgtcagaaacagaattatgtagccgttgcagcgatcctgatcgtcgtcag
gatcagttatgcattgttgagatgccaagtgatgttctggctattgagcaggcgacggct
tatcagggccaatactttgtcttgaatggacatctttcgccactcgatggcattggcccc
gaaacactcggcattccaacattaatccgctggctggatagccaagaaactgaagaaata
attctagcaacaaatcccactgttgaaggcgaagccacggcgcactatatttcagagctg
gcgcgtgctagacaaattcgtgttacccgattagcacatggaatcccgcttgggggtgag
ttagagtatgttgatagcactaccttatcgcatgctttcgccggccgaggcacagtctga

DBGET integrated database retrieval system