KEGG   Methylophaga sp. JAM7: Q7C_690Help
Entry
Q7C_690           CDS       T02056                                 

Definition
N-succinyl-L,L-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mec  Methylophaga sp. JAM7
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mec01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mec00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740975..742114
Genome map
AA seq 379 aa AA seqDB search
MTHNLSPTIALTQQLIRRQSITPDDADCQEMLGQRLAEIGFIAETMRFADVDNLWLRRGK
REPLFVFAGHTDVVPTGPADKWASPPFNADIVDGLLYGRGAADMKGSIAAMVTACERFVE
RYPDHRGSIAFLLTSDEEGPATDGTVKVIETLQTRQENIDWCVVGEPTSSQRVGDVVKNG
RRGSLNGYLTVKGKQGHIAYPHLAENPIHRLAPALTALCAEIWDQGNDDFPPTSFQVSNL
NSGTGATNVIPGTVEMVFNFRYSTEVTHEQLAQRTEMILQQHGLHYDLKWVLSGKPFRTA
GGALLTAVQQAISDITGYKTELSTSGGTSDGRFIAPTGAQVIELGPLNATIHQIDECVSI
ADLDTLSSIYEALLVKLLT
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacgcataacctctccccaaccattgcgttaacgcagcaactcattcgtcgtcagagc
atcactcctgatgatgcagactgccaggaaatgcttggccagcgattggcagaaataggt
tttattgccgaaacgatgcggtttgctgatgtggataacctctggttgcgccgcggcaaa
cgcgaacccttgtttgtttttgccggccatacagatgttgtgcccacagggccggcagat
aaatgggcctcgccccctttcaatgccgatattgtcgatggtctgttgtatggccgaggt
gctgccgacatgaaaggcagcattgctgctatggtgaccgcatgtgagcggtttgttgaa
cgttaccctgatcatcgcggcagcattgcatttttattaaccagtgatgaagaaggtcca
gcaacagacggcacggttaaggtcatcgaaacgttgcagaccagacaggaaaacattgac
tggtgtgtggttggcgaaccgaccagtagtcagcgtgttggcgatgtggttaaaaatggt
cgtcgcggatccttgaatggctatttgaccgttaagggcaaacaaggccatattgcttat
ccgcatcttgctgagaacccaattcatcgtttagcgccagcattaacggctttatgcgca
gagatctgggatcagggtaacgatgacttcccgccgaccagttttcaggtgtctaatctg
aacagtggcacgggggcaaccaatgtcattcccggcaccgttgagatggtttttaacttc
cggtattccaccgaagtcactcatgagcaactggctcaacgtacagaaatgattttgcaa
cagcatggcctgcactatgacttgaaatgggtattgtccggaaaaccttttcggactgcc
ggcggtgccctgcttactgccgtccagcaggccattagcgacattactggctacaaaact
gagctgtctacctccggtggtacctccgatgggcggtttatcgcgccaacaggcgcacaa
gtcatcgaacttggtccactcaatgccacgatccatcagattgatgaatgtgtttctata
gcggatttagatacgttatcgtccatctatgaagcacttctggtcaaattgttgacctga

DBGET integrated database retrieval system