KEGG   Methylophaga frappieri: Q7C_780Help
Entry
Q7C_780           CDS       T02056                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mec  Methylophaga frappieri
Brite
Enzymes [BR:mec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Q7C_780
Secretion system [BR:mec02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Q7C_780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(836775..837503)
Genome map
AA seq 242 aa AA seqDB search
MKYFLWPLLALLFIPTVYAADAEVTALKDKLRQDVPEMQIQSLKPVGDSGLYEAVIDDRI
FYLTKDGDYLIQGNVLALASRENITQQRQLEIKQAVLARQPESDLIVFAPENPDYMLTVF
TDVDCGYCRKLHEQIAEYNDQGIGIRYMAFPRAGADSESATKLEQVWCAEDRQQAMTDAK
ANRDINGKVCEDNPVLAQFDTGRRLGVEGTPALFLNNGQMLPGYVPPAKLREILDEYASL
AP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattttctctggccattgctggccttattattcattcccactgtctatgccgct
gatgcagaggtaacagcgctaaaagataaattgcgtcaggatgtaccagaaatgcaaatc
caatcactcaagccagtcggcgacagtggtttgtacgaggcggtcattgatgatcgtatt
ttttatcttactaaagacggtgattaccttatccaaggtaatgtccttgcgctggccagt
agagaaaatatcacgcaacaacgacaacttgagattaaacaggctgttttagcgcgccag
ccagagtcagacttgattgtattcgctccagagaatcctgattatatgttgacggtattt
accgatgttgactgtggttactgccgtaaattgcatgagcaaatcgcagaatacaatgac
caaggtattggtattcgatatatggcatttccacgtgccggggccgattcagagtcggca
accaagttggaacaagtctggtgtgctgaagaccgccagcaagcgatgaccgatgccaaa
gctaatcgcgacatcaatggcaaggtttgtgaagacaatccggtgttggctcagtttgat
acgggtcgtcgccttggggtagagggaacgcctgccttgtttttgaataatggtcagatg
ttaccgggctatgtgccaccagcgaagctgcgtgaaattctggatgaatacgctagtttg
gcaccgtaa

DBGET integrated database retrieval system