KEGG   Megasphaera elsdenii: MELS_0252Help
Entry
MELS_0252         CDS       T01633                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
med  Megasphaera elsdenii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MELS_0252
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MELS_0252
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MELS_0252
Enzymes [BR:med01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MELS_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(283315..284499)
Genome map
AA seq 394 aa AA seqDB search
MSTGRFGPFGGQYIPETLMNEIQRLEKAYSHYKNDPDFQAELKDLLDNYANRPSLLYYAE
RMTKDLGGAKVYLKREDLNHTGAHKINNALGQCLLAKKMGKTRVIAETGAGQHGVATATA
AAFLGLECEVFMGEEDTIRQALNVYRMELLGAKVHAVTSGSRVLKDAVNEAMREWVSRVD
DTHYVIGSTMGPHPFPMMVRDFQSVISKEARQQILEREGKLPSAVLACVGGGSNAMGMFY
HFIGDKDVKLIGCEAAGKGIDTKLHAATIAKGEVGIFHGMKSIFCQNEDGQIDEVYSISA
GLDYPGIGPEHAYLHQTGRAQYVPVKDDEAVEAFEYLARTEGIICAIESAHAVYEAMQIA
PKMSKDDSIIVCLSGRGDKDVAAIARYKGRDLHE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaggaagatttggccccttcggcggtcaatatataccggaaacattgatgaat
gaaatccagcgcttggaaaaagcctacagccattataaaaatgatcccgattttcaggca
gaattgaaggatttgctcgataattatgccaaccgtccgtccctgctctactatgccgaa
cgcatgaccaaggacctgggcggcgcgaaagtttatttgaagcgcgaagatttgaaccat
acaggcgcccataagatcaacaacgccctgggtcagtgcctgttggccaagaagatgggc
aagacacgggtcatcgctgaaaccggtgccggccagcacggcgtcgctacggcgacagca
gcggctttcttaggccttgaatgtgaagtcttcatgggcgaagaagatacaatccgccag
gcattgaacgtctaccgcatggaactcttaggggctaaagtccacgctgtcacatcgggt
tcgcgagtcctcaaagatgctgtcaatgaagccatgcgcgaatgggtcagccgtgtcgac
gatacacactacgtcatcggttcgactatgggtcctcatccgttcccgatgatggtccgc
gacttccagtccgttatcagcaaggaagcgcgtcagcagattctcgaacgggaagggaaa
ttgccttccgctgtcctggcctgcgttggtggcggcagcaatgccatgggcatgttctac
catttcatcggcgataaggacgtcaaactcatcggttgtgaagcggccggcaagggcatc
gacaccaagctccatgcagcgactatcgccaaaggggaagtcggtatcttccatggcatg
aaatccattttctgccagaatgaagacggccagatcgacgaagtctattccatttcggcc
ggcctcgactatccgggcatcgggccggaacacgcttatctccaccagacgggacgcgcc
cagtatgtaccggtcaaggacgacgaagccgtcgaagcttttgaatacctggcccgcacg
gaaggcatcatctgcgccatcgaaagcgcccatgccgtctatgaagccatgcagatagcg
ccgaagatgagcaaagacgacagcatcatcgtctgcttgtccggccgcggtgataaagac
gtcgccgccattgcaagatataaagggagggacttacatgagtaa

DBGET integrated database retrieval system