KEGG   Megasphaera elsdenii: MELS_0262Help
Entry
MELS_0262         CDS       T01633                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
med  Megasphaera elsdenii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:med00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:med00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(296896..297447)
Genome map
AA seq 183 aa AA seqDB search
MNVYDFTVKDIQGHDVSLSQYKDKVLLIVNTASKCGFTPQYDGLEALYQKYKDKGLVILG
FPCNQFLEQDPEDNQHIEQFCRLNHGVTFPLFAKIDVRGDQAAPLYQYLTEAAPFKGYET
DKESGQLIQKVVSEHYPDNAQGNGIKWNFTKFLINRDGSQVQRFEPSTTPEELDPILEKL
LLS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatacgatttcacggtcaaagatatccagggacacgatgtatccctgagccag
tataaagataaggtcctgctcatcgtcaatacagccagcaaatgtggcttcacgccgcaa
tacgacggcctggaagccttatatcagaaatataaggataaaggcctggtcatcctcggc
ttcccgtgcaaccagttcctggaacaggatccggaagacaaccagcacatcgaacagttc
tgccgcctcaaccacggcgtcaccttcccgctcttcgccaagatcgacgtccgcggtgac
caggcagcacctttgtaccaataccttacagaagccgcacccttcaaaggctacgaaacg
gataaagaaagcggccagctcatccagaaggtcgtttccgaacactatccggacaatgcc
cagggcaacggcatcaaatggaatttcactaaattcctcatcaaccgggacggcagtcag
gtccagcgctttgaacccagcacgacaccggaagaattagacccgatcctcgaaaaacta
ctcctctcctaa

DBGET integrated database retrieval system