KEGG   Megasphaera elsdenii: MELS_0262Help
Entry
MELS_0262         CDS       T01633                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
med  Megasphaera elsdenii
Pathway
med00480  Glutathione metabolism
med00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MELS_0262
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MELS_0262
Enzymes [BR:med01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MELS_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CCC72485
UniProt: G0VLA5
Position
complement(296896..297447)
Genome map
AA seq 183 aa AA seqDB search
MNVYDFTVKDIQGHDVSLSQYKDKVLLIVNTASKCGFTPQYDGLEALYQKYKDKGLVILG
FPCNQFLEQDPEDNQHIEQFCRLNHGVTFPLFAKIDVRGDQAAPLYQYLTEAAPFKGYET
DKESGQLIQKVVSEHYPDNAQGNGIKWNFTKFLINRDGSQVQRFEPSTTPEELDPILEKL
LLS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatacgatttcacggtcaaagatatccagggacacgatgtatccctgagccag
tataaagataaggtcctgctcatcgtcaatacagccagcaaatgtggcttcacgccgcaa
tacgacggcctggaagccttatatcagaaatataaggataaaggcctggtcatcctcggc
ttcccgtgcaaccagttcctggaacaggatccggaagacaaccagcacatcgaacagttc
tgccgcctcaaccacggcgtcaccttcccgctcttcgccaagatcgacgtccgcggtgac
caggcagcacctttgtaccaataccttacagaagccgcacccttcaaaggctacgaaacg
gataaagaaagcggccagctcatccagaaggtcgtttccgaacactatccggacaatgcc
cagggcaacggcatcaaatggaatttcactaaattcctcatcaaccgggacggcagtcag
gtccagcgctttgaacccagcacgacaccggaagaattagacccgatcctcgaaaaacta
ctcctctcctaa

DBGET integrated database retrieval system