KEGG   Megasphaera elsdenii: MELS_0319Help
Entry
MELS_0319         CDS       T01633                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
med  Megasphaera elsdenii
Pathway
med00790  Folate biosynthesis
med01100  Metabolic pathways
Module
med_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MELS_0319
Enzymes [BR:med01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MELS_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF3783 CAT_RBD
Motif
Other DBs
NCBI-ProteinID: CCC72542
UniProt: G0VLG2
Position
complement(365384..366220)
Genome map
AA seq 278 aa AA seqDB search
MEVRHYHWKDGKSLTVGERTLVMGVLNYTPDSFSDGGKWNNVDVALKHMEEMVADGADII
DIGAESARPGFTPISAAEEIARLETILPRLVAACPVPISVDTYKAETAEYAMSTGAHIMN
DIWGLQYAPEPGKMAAVAAKYGVPVVVMHNQEGTEYDDIIEDMKRFFIRSAIIADQAGMS
QDQIITDPGIGFGKDFDQNVYVMKHLQELTALPYPMLLGTSRKGFIGKILDLPVTERMEG
TETTCVAGVLAGCTIVRVHDVKPIVRMCKMADALRPEK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaagttcgtcattatcattggaaagatggaaaatcgctgaccgttggggaacggacg
ctggtcatgggcgtcctcaattatacgcccgattctttttcggatggcgggaaatggaat
aacgtcgatgtggccttgaagcatatggaagagatggtagctgacggcgccgatatcatc
gacatcggtgctgaatcggcacgtcccggctttacgccgatttcggcagctgaagaaatc
gcccggctggaaacgattttgccgcgcctggtcgcagcctgcccagtgcccatttctgtc
gatacgtacaaggcggaaacggctgaatatgccatgagtacgggcgcccatatcatgaat
gatatctggggcctccaatacgcgccggaaccggggaagatggctgctgtcgccgccaaa
tacggcgtccctgtcgtcgtcatgcataaccaggagggtacggaatacgacgatatcatc
gaagatatgaaacgctttttcatccgctcggccatcattgctgaccaggcaggcatgagc
caggaccagatcatcactgacccgggcatcggctttggcaaggattttgaccagaatgtc
tacgttatgaaacatttgcaggaactgacggccctgccttatcccatgctcctgggaacg
agccggaaaggcttcatcggcaagatcctggacctgccggtgacggaacggatggaaggg
actgagacgacctgtgtagccggcgttttggcaggctgcaccattgtccgggtccacgat
gtcaaacccatcgtccgcatgtgcaagatggccgacgccctgcgtccggaaaagtag

DBGET integrated database retrieval system