KEGG   Megasphaera elsdenii: MELS_0365Help
Entry
MELS_0365         CDS       T01633                                 

Definition
beta-glucosidase-related glycosidases
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
med  Megasphaera elsdenii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MELS_0365
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MELS_0365
Enzymes [BR:med01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MELS_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(416056..417201)
Genome map
AA seq 381 aa AA seqDB search
MKKRNAKSGIFLALAVLVLVLAGAWFFWNRSPAVPSPSSPGGTVQEDEAARLVHKMSPEE
KIGQLMMIGLAGTTIDDQAQRQLEYCHAGNVILFDRNMDRPDQVQHLTKKIDTTIRKKSG
VMPFIALDQEGGQVLRMRKAFPPIPSEQAIGQSGQPEQAKQWALTTGTELKKLGINVNFA
PVVDLGSQAERSYSLDPGVVTQFAHEAVAGYGQAGIWCSLKHFPGIGKVKTDPHIDGDSV
NSSKDELLKQDLKPFENLIKREDNQKMFIMVSNVTFPALDPNLPACVSKPIMTDLLRHTF
GYQGLIVSDDMEMGAMAKHYAFADMGVMAIKAGADIVLVCHEYAHERETYDGLLKEYKNN
ADFRALVDEKVTRIVRTKLNH
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcgtaatgccaagagcgggattttcctggccctggccgtcctggtcctcgtg
ctagctggggcttggttcttctggaatcggtcaccggcagtaccttcgccgtcttctcct
ggcgggaccgtacaggaagacgaggcggccagattggtccacaagatgtcgccagaagaa
aagatcggccagctcatgatgatcggcctggccgggacgaccatcgacgaccaggcccag
cgccagctggaatactgccacgccgggaatgtcatcttattcgaccgcaatatggacagg
cccgaccaggtccagcatctgaccaaaaaaatagacacgacgatccgcaagaagagcggc
gtcatgccttttattgccctcgatcaggaagggggccaggtcctgcgcatgcgcaaggct
ttcccgccgattccttcggaacaggccatcggacagagcggccagccggagcaggccaaa
cagtgggcccttacgacggggactgagttgaagaaactgggtatcaatgtcaatttcgct
cctgtcgtcgacctaggctcccaggccgaacggtcgtacagcctcgaccccggcgtcgtg
acccagttcgcccatgaagccgttgccggctatggacaggccggtatctggtgctccttg
aagcatttcccgggcattggcaaagtcaagacggatcctcacattgacggggacagcgtc
aacagctctaaggatgaactcttgaaacaggatttgaagccctttgagaacctcatcaag
cgcgaagacaatcagaaaatgttcatcatggtctcgaacgtcaccttccccgctttggac
cccaatctgccggcctgcgtctccaagccgatcatgaccgacttgttgcgccacactttc
ggctaccagggtctcatcgtttccgacgatatggaaatgggggccatggccaaacactat
gcctttgccgacatgggcgtcatggctatcaaggccggtgctgatatagtcctggtctgc
catgaatatgcccatgaacgggaaacctatgacggcctcttgaaggaatataagaacaat
gcagacttccgggccttagtcgatgaaaaagttacccgcatcgtccgcaccaaactgaat
cattaa

DBGET integrated database retrieval system