KEGG   Megasphaera elsdenii: MELS_0410Help
Entry
MELS_0410         CDS       T01633                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
med  Megasphaera elsdenii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MELS_0410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MELS_0410
  Lipid metabolism
   00071 Fatty acid degradation
    MELS_0410
  Amino acid metabolism
   00350 Tyrosine metabolism
    MELS_0410
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MELS_0410
   00626 Naphthalene degradation
    MELS_0410
Enzymes [BR:med01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MELS_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(465496..466665)
Genome map
AA seq 389 aa AA seqDB search
MSFQMFVPTKALFGAGQLNHLHEQDFPGKKALLVISNGKSTKVNGYLDRTEKELHTAGVE
TVLFDQVEANPLKSTVMRGGAMAREHQCDFIVALGGGSCIDAAKGIAVVATNDGDLWDYI
TQGTGKGKPIAIKPLPIVAITTTAGTGSETDAGGVITNEDTNEKTPVKGPSLFPVLAIID
PELMATVPPKFTAYQGFDALFHNIEGYLANKANLMSEMVALEAISQISAYLPTAVQNGID
MKARERVAFGNYLGGLEMCLSSNMSEHSLEHALSAYHQALPHGAGLIMISLAYFSHMIDI
HVCDDRFIILARHMGRPDAAKPEDFLDALKELQEKCGVANLKMSDYGISPDEFHKMAHNA
KTAMAGLFMADRMPMSEDDCVAIYQASYR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttttcagatgtttgtccctacgaaagcgttatttggtgctggtcagctcaaccat
ttacatgaacaggattttcccggcaagaaagctttgctggtcatttccaatgggaaatcg
actaaggtcaacggctacctggaccggacagaaaaagaactgcatacagccggcgtcgaa
acggtcctttttgaccaggtcgaagccaatcccttaaagtcgacggtcatgcgcggcggt
gctatggctcgggaacatcagtgtgacttcatcgtggccttaggcggcggcagctgtatc
gatgcggccaaagggattgccgtcgtagcgaccaatgacggtgatttgtgggattacatc
acgcagggcacgggcaagggcaagcccattgccataaaacctctgcctatcgtagccatt
acgacgacggccgggactggttcggaaaccgatgccggcggcgtcatcaccaatgaagat
acgaatgaaaagacacctgtcaaaggcccgtccctgtttccggtcctggctatcatcgac
ccggaactgatggcgacggtgccgccgaaattcacggcttatcaggggttcgacgccctg
ttccacaacatcgagggctatctggccaataaagccaatctgatgagtgaaatggtcgcc
ttggaagccatctcccagatcagcgcctatttgccgacggctgtccagaacggcatcgac
atgaaggcccgggagcgcgtcgctttcggtaactatctcggcggtctggaaatgtgcctc
agctccaatatgagtgagcactcactggaacacgccctcagcgcctatcaccaggccctg
ccccacggtgccggcctcatcatgatcagcctggcttatttctcgcacatgatcgacatc
cacgtctgtgacgaccgcttcattatcctggcccgccatatgggccgtcctgatgcggca
aaaccggaagacttcctcgatgccctgaaggaattacaggaaaaatgcggcgtcgccaat
ctcaagatgtccgattacggcatcagtcccgacgaattccataaaatggcccataatgcc
aagacggctatggcgggattattcatggccgaccgcatgcctatgagcgaagacgactgt
gtcgctatttatcaggcatcttatcgctaa

DBGET integrated database retrieval system