KEGG   Megasphaera elsdenii: MELS_0410Help
Entry
MELS_0410         CDS       T01633                                 

Definition
(GenBank) putative uncharacterized protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
med  Megasphaera elsdenii
Pathway
med00010  Glycolysis / Gluconeogenesis
med00071  Fatty acid degradation
med00350  Tyrosine metabolism
med00625  Chloroalkane and chloroalkene degradation
med00626  Naphthalene degradation
med01100  Metabolic pathways
med01110  Biosynthesis of secondary metabolites
med01120  Microbial metabolism in diverse environments
med01130  Biosynthesis of antibiotics
med01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MELS_0410
  Lipid metabolism
   00071 Fatty acid degradation
    MELS_0410
  Amino acid metabolism
   00350 Tyrosine metabolism
    MELS_0410
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MELS_0410
   00626 Naphthalene degradation
    MELS_0410
Enzymes [BR:med01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MELS_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CCC72633
UniProt: G0VM71
Position
complement(465496..466665)
Genome map
AA seq 389 aa AA seqDB search
MSFQMFVPTKALFGAGQLNHLHEQDFPGKKALLVISNGKSTKVNGYLDRTEKELHTAGVE
TVLFDQVEANPLKSTVMRGGAMAREHQCDFIVALGGGSCIDAAKGIAVVATNDGDLWDYI
TQGTGKGKPIAIKPLPIVAITTTAGTGSETDAGGVITNEDTNEKTPVKGPSLFPVLAIID
PELMATVPPKFTAYQGFDALFHNIEGYLANKANLMSEMVALEAISQISAYLPTAVQNGID
MKARERVAFGNYLGGLEMCLSSNMSEHSLEHALSAYHQALPHGAGLIMISLAYFSHMIDI
HVCDDRFIILARHMGRPDAAKPEDFLDALKELQEKCGVANLKMSDYGISPDEFHKMAHNA
KTAMAGLFMADRMPMSEDDCVAIYQASYR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttttcagatgtttgtccctacgaaagcgttatttggtgctggtcagctcaaccat
ttacatgaacaggattttcccggcaagaaagctttgctggtcatttccaatgggaaatcg
actaaggtcaacggctacctggaccggacagaaaaagaactgcatacagccggcgtcgaa
acggtcctttttgaccaggtcgaagccaatcccttaaagtcgacggtcatgcgcggcggt
gctatggctcgggaacatcagtgtgacttcatcgtggccttaggcggcggcagctgtatc
gatgcggccaaagggattgccgtcgtagcgaccaatgacggtgatttgtgggattacatc
acgcagggcacgggcaagggcaagcccattgccataaaacctctgcctatcgtagccatt
acgacgacggccgggactggttcggaaaccgatgccggcggcgtcatcaccaatgaagat
acgaatgaaaagacacctgtcaaaggcccgtccctgtttccggtcctggctatcatcgac
ccggaactgatggcgacggtgccgccgaaattcacggcttatcaggggttcgacgccctg
ttccacaacatcgagggctatctggccaataaagccaatctgatgagtgaaatggtcgcc
ttggaagccatctcccagatcagcgcctatttgccgacggctgtccagaacggcatcgac
atgaaggcccgggagcgcgtcgctttcggtaactatctcggcggtctggaaatgtgcctc
agctccaatatgagtgagcactcactggaacacgccctcagcgcctatcaccaggccctg
ccccacggtgccggcctcatcatgatcagcctggcttatttctcgcacatgatcgacatc
cacgtctgtgacgaccgcttcattatcctggcccgccatatgggccgtcctgatgcggca
aaaccggaagacttcctcgatgccctgaaggaattacaggaaaaatgcggcgtcgccaat
ctcaagatgtccgattacggcatcagtcccgacgaattccataaaatggcccataatgcc
aagacggctatggcgggattattcatggccgaccgcatgcctatgagcgaagacgactgt
gtcgctatttatcaggcatcttatcgctaa

DBGET integrated database retrieval system