KEGG   Megasphaera elsdenii: MELS_0477Help
Entry
MELS_0477         CDS       T01633                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
med  Megasphaera elsdenii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:med03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(554767..555357)
Genome map
AA seq 196 aa AA seqDB search
MDTPLDKLTEEFRRLPGIGVKTARKLAYYIVQQPASRVDEFVDAIRDAKANMHFCSVCFN
LSSQDPCPICSDISRDRSTICVVETPQDVQAIERSGDYHGLYHVLHGALSPLDGVNVEDL
RIRELLQRLGNTTVKEVILATDPDVEGEATALYLARLIKTAGIRVTRIARGLPMGGDIEY
ADEATLAGAVANRQEM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggatacgccattagataagctgacggaagagttccgccgccttcccggcattggcgtc
aagacggcacgcaagctggcctactatatcgtccagcagccggccagccgtgtcgacgaa
tttgtcgatgctatccgcgatgccaaagcgaatatgcacttctgctcggtctgcttcaac
ttatcgtcccaggatccgtgcccgatttgcagcgacatcagccgcgaccgctcgacgatc
tgcgtcgtcgaaacgccgcaggatgtccaggccattgaacgcagcggcgattaccacggc
ttatatcacgtcctgcacggggccttatcgcctttagacggcgtcaacgtcgaagacctg
cgtatccgcgagctcctgcagcgtctggggaatacgacggtcaaggaagtcatcttggct
accgatcctgacgtagaaggcgaagcgacggcgttatacctggcccgcctcatcaagacg
gccggcatccgcgtgacccgcattgcccgcgggcttcccatgggcggcgacattgaatat
gctgacgaagcgacgctggctggtgccgttgccaatcggcaggaaatgtga

DBGET integrated database retrieval system