KEGG   Megasphaera elsdenii: MELS_0576Help
Entry
MELS_0576         CDS       T01633                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
med  Megasphaera elsdenii
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:med00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
667868..668872
Genome map
AA seq 334 aa AA seqDB search
MKPKLSILDPNPTPLQYLSGLSQELFREIYIKRDDLTPFGGGGNKLRKLEYLMIEALNSQ
ATTIVTVGGPQTNHGRLTAAVAAKFGLKCIIVAVGDTDGELSGNLLLDGIFGARVVLKHD
DGRDQDVQLEETVKKVMAAELKKGEQVYFIPMGGSDTTGMLGYMDCARELDAQAKEQQID
GATVYVAVGSMGTYLGLYCGLKAIQSNLKLVGIAVMPFDMEKLKAYFQQAKEEYGFDFDG
DFHVETGYIGKGYNEPEPRVREAIYTMARHEGILLDPCYTGKMFAGVLSMIKEKKIKLGR
QVILLHTGGMPGLYTKAHRIKFENELKDQIEIVK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgaaactttctattttagaccccaatccgacgccgcttcagtacctgtccggc
ttgtcgcaggaattattccgtgaaatctacatcaagcgcgatgacctgacgcctttcggc
ggcggtggcaataaactgcgtaaattagagtatttgatgatcgaagccctcaattctcag
gcgacgaccattgtcaccgtcggcggaccgcagaccaatcatggccgcctgaccgctgcc
gttgccgctaaattcggcttgaaatgcatcatcgtcgccgttggcgatacggacggcgaa
ttgagcggcaatctgctcctcgacggcatcttcggcgcccgcgtcgtcctcaagcatgat
gatggccgcgaccaggacgtccagctcgaagaaacagtcaaaaaagtcatggctgccgaa
ttgaagaagggggaacaagtttacttcattcccatgggcggcagcgatacgacgggcatg
ctgggctatatggactgtgcccgcgaactcgatgcccaggccaaggaacagcagatcgac
ggagcgacggtctatgtcgccgtcggcagcatgggcacatatctcggcttatactgcggc
ctgaaagccattcagtcgaacttgaagctggtagggattgccgtcatgcccttcgatatg
gaaaaactgaaggcgtacttccagcaggctaaagaagaatacggctttgattttgacggc
gacttccacgtcgaaacgggctatatcggcaagggctacaatgaaccggaaccgcgggtc
cgcgaagccatttacaccatggcccgccacgaaggcatcctcctcgacccgtgctacacg
ggcaagatgtttgccggcgtcctgtcgatgatcaaagaaaagaaaatcaaactgggccgc
caggtcatcctcctgcacaccggcggtatgcccggcctgtacaccaaagctcaccgcatc
aaatttgaaaacgaactcaaagaccagatcgagattgtgaagtaa

DBGET integrated database retrieval system