KEGG   Megasphaera elsdenii: MELS_0638Help
Entry
MELS_0638         CDS       T01633                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
med  Megasphaera elsdenii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:med00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
745081..746586
Genome map
AA seq 501 aa AA seqDB search
MQEKQYVMALDAGTTSNRAIIFDNESHIVSVSQKEFTQYFPKPGWVEHDANEIFHSMVEV
MREALAQANMTASEISAIGITNQRETTVVWDKNTGDPVYNAIVWQSRQTAPICEDLKARG
LVDEFRDKTGLVIDAYFSGTKVKWILDNVEGAREKAEKGDLLFGTIDCWLVWKLTGGQVH
ITDYSNASRTLMFNIKELKWDDQLLEYLTVPKCMLPEVRPSSEVYGCTDPAILGGPVNIA
GIAGDQQAALFGQTCYEPGMAKNTYGTGCFMLMNTGTTPIPSKNGLVTTIAWGLDGKVEY
ALEGSIFVAGSAIQWLRDGLRLIDTAPDSEWVAKRVPDSDGVYVVPAFVGLGAPYWDMDA
RGLIIGITRGTKKSHIVRATLDSMAYQTKDVLGAMEADSGIKLAALKVDGGAVANNMLMQ
FQADILGVPVDRPQVIETTALGAAYLAGLAVGVWDSKEELVSSWKLQNRFEPTMEPEKAA
GYYKGWRKAVKHAMHWLSDED
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaagcagtatgttatggccttggacgccggcaccacgagtaatcgtgctatt
attttcgataatgaatcgcatatcgtcagcgtcagccagaaggaattcacccagtatttc
ccgaaaccgggctgggtcgaacacgatgccaatgaaattttccacagcatggtcgaagtc
atgcgcgaagccttggcacaggccaatatgacagccagtgaaatctcggccatcggcatc
accaaccagcgtgaaacgacagtcgtctgggataagaacacgggcgaccccgtgtacaac
gccatcgtctggcagtcccgtcagaccgccccgatttgcgaagacctcaaggcccgcggc
ctggtcgatgaattccgtgacaagacgggcttggtcatcgacgcttatttctcgggcacg
aaagtcaaatggatcttggacaacgtcgaaggcgcccgggaaaaagctgaaaaaggcgac
ctcctcttcgggaccatcgactgctggctggtctggaaactgacaggcggccaggtccac
atcacagactactccaatgcgtcgcgtacacttatgttcaacatcaaagaactgaagtgg
gacgaccagcttcttgaatatttaaccgttcctaaatgcatgctcccggaagtacgcccg
tccagtgaagtctatggctgcacggatccggccatcctcggcggtccggtcaacatcgcc
ggtatcgctggtgaccagcaggcagccctcttcggccagacctgctatgaaccgggtatg
gctaagaatacctatggtacaggctgcttcatgctcatgaatacgggcacgacaccgatt
ccttccaagaacggcctggttacgaccatcgcctggggcctcgacggcaaagtcgaatat
gccctggaaggttccatcttcgtcgccggttcggccatccagtggctccgcgacggcctg
cgcctcatcgatacggctcccgattcggaatgggtcgctaaacgcgttcccgattcggac
ggcgtctatgtcgtaccggctttcgtcggcctcggcgctccctactgggatatggatgcc
cgcggcttgatcatcggcatcacccgcggcaccaagaagtcacacatcgtccgggctacc
ctcgattctatggcttaccagacgaaagacgtcctcggcgccatggaagcggactcgggc
atcaaactggctgccctcaaagtcgacggcggtgccgttgccaacaacatgctcatgcag
ttccaggccgatatcctcggcgttcctgtcgaccgtcctcaggtcatcgaaacgacggct
ctcggtgccgcttatctggctggtctggctgtcggcgtctgggattctaaagaagaactc
gtatcgagctggaaactccagaaccgttttgaaccgaccatggaaccggaaaaagcagca
ggttactacaaaggctggcgcaaagctgtcaagcatgcaatgcactggctcagcgatgaa
gactaa

DBGET integrated database retrieval system