KEGG   Megasphaera elsdenii: MELS_0761Help
Entry
MELS_0761         CDS       T01633                                 

Definition
fructose-1
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
med  Megasphaera elsdenii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:med01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:med00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:med00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:med00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:med00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
886362..888275
Genome map
AA seq 637 aa AA seqDB search
METYDTYSPEYLRYLELLSKEYPTQAATFTEIINLQAIVNLPKGTEHFMSDLHGEYEAFY
HILNNCSGVIREKVEMIFSDKMSKAEQDDLLTLIYYPKEKLNMLYREGKVNDDWARTTLE
RMIDLAKLLSSKYTRSKVRKAMPEVFRFVIDELLHAQPDEDQNQLVYHMKILDTILETGS
TRQFIYALANLIKRLAVDHLHIIGDIYDRGAHADKIMDTLMHHHSLDIQWGNHDVLWMGA
AAGNAACIANVLRNNIRYHNMEILESGYGISLRPFALFALDTYKQDDGMEPMVKAINVIV
AKLEGQTIYRHPDYNMDDRLLFHKIDWEKGVITLGGKTYELKTKDFPTVNPQDPYTLSPE
EHQLMNDIQVEFTESERLQRHIRFLYSHGSLYRCMNNNLLFHGGLPLNEDGSFKEIYLDG
KPYKGKAFMDKAEHLIRRAYDQRDTDSLDYMWYLWCGADSPVSGRIVKTFERSYIIDEST
WKEPQNAYYRLNRDKDECIKILHEFGIDSPQGHIINGHTPVKVKKGESPIRAEGKEICID
GGFCKAYQGSTGIAGYTLIFNSHGIRIKSHYPFEDVYQALMNNVDIDSESTQVELEPKRV
MIGDTDNGKKLLQMIRDLKALLEAYRQGVILERRPNP
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgtacgatacttattctcccgaatatctgcgctatttggagctcttgtccaag
gagtatccgacacaggctgcgacgtttacagaaatcatcaacctgcaggcgattgtcaat
ctgcccaaggggacggaacacttcatgagtgacctgcacggcgaatatgaagccttttat
cacatcctgaacaactgctccggcgtcatccgggaaaaagtagaaatgattttttctgac
aagatgagcaaggccgaacaagatgacttattgacgctcatttactatccgaaagaaaaa
ctgaacatgctataccgagaaggcaaggtcaacgatgactgggcccggacgacgctggaa
cggatgatcgacctggccaagctcttgtcttcgaagtacacgcggtcgaaggtccgtaaa
gccatgccggaagtcttccgcttcgtcatcgatgaactcttgcatgcccagcccgatgaa
gaccagaatcagctggtctaccatatgaaaatcctcgataccatcttagaaacgggcagt
acgcggcaattcatctacgctttggccaatctcatcaaacgcctggctgtcgatcacttg
cacatcatcggcgatatttacgaccgcggcgctcatgccgataagatcatggataccctc
atgcaccatcattccctggacatccagtggggcaaccacgacgtcctttggatgggggcc
gctgccggcaatgccgcctgcatcgccaatgtcctgcgcaataacatccgttaccataat
atggaaatattagaaagcggttatggcatcagcctgcgcccctttgccctgttcgccttg
gatacgtataaacaggacgacggcatggaaccgatggtcaaggccatcaacgtcatcgtg
gctaaactggaaggccagacgatttaccgtcatcccgactataatatggacgaccgcctg
ttgttccataaaatcgattgggaaaaaggcgtcatcaccctcggtggcaagacgtatgaa
ctgaagaccaaagatttcccgaccgtcaacccgcaggacccgtatacactgtcgccggaa
gaacatcagctcatgaatgacatccaggttgaatttaccgaaagcgaacgccttcagcgc
catatccgcttcctctacagccacggttctttataccgctgcatgaataacaacctcttg
ttccacggcggcctgccccttaatgaagacggcagtttcaaggaaatctacctcgacggc
aagccgtataagggcaaggcattcatggataaagcggaacacctcatccgccgggcttac
gaccagcgcgatacggacagcctggattatatgtggtatctctggtgcggtgctgattct
cccgtatccggccgtatcgtcaagacttttgaacggagttacatcatcgatgaatcgacg
tggaaagagccgcagaatgcttactaccgcctgaatcgcgataaagatgaatgtatcaag
atccttcacgaatttggcatcgactcgccccaaggccacatcatcaatggccatacgccg
gtcaaggtcaagaaaggcgaaagcccaatccgtgcggaaggcaaggaaatctgcatcgac
ggcggtttctgcaaagcttatcagggctctacgggcattgccggttacacgctcatcttc
aactcccatggtatccgcatcaaatcccactatccctttgaagacgtctatcaggccctc
atgaacaatgtcgacatcgattccgaatcgacacaggtcgaattggaaccgaagcgggtc
atgatcggcgacacggataacggtaagaaactcctgcagatgatccgcgacttgaaggct
ctcttggaagcctatcgtcaaggcgtcatccttgaacgtcgcccgaatccgtag

DBGET integrated database retrieval system