KEGG   Megasphaera elsdenii: MELS_0761Help
Entry
MELS_0761         CDS       T01633                                 

Definition
(GenBank) fructose-1
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
med  Megasphaera elsdenii
Pathway
med00010  Glycolysis / Gluconeogenesis
med00030  Pentose phosphate pathway
med00051  Fructose and mannose metabolism
med00680  Methane metabolism
med01100  Metabolic pathways
med01110  Biosynthesis of secondary metabolites
med01120  Microbial metabolism in diverse environments
med01130  Biosynthesis of antibiotics
med01200  Carbon metabolism
Module
med_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MELS_0761
   00030 Pentose phosphate pathway
    MELS_0761
   00051 Fructose and mannose metabolism
    MELS_0761
  Energy metabolism
   00680 Methane metabolism
    MELS_0761
Enzymes [BR:med01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MELS_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos PP1_inhibitor
Motif
Other DBs
NCBI-ProteinID: CCC72983
UniProt: G0VNF5
Position
886362..888275
Genome map
AA seq 637 aa AA seqDB search
METYDTYSPEYLRYLELLSKEYPTQAATFTEIINLQAIVNLPKGTEHFMSDLHGEYEAFY
HILNNCSGVIREKVEMIFSDKMSKAEQDDLLTLIYYPKEKLNMLYREGKVNDDWARTTLE
RMIDLAKLLSSKYTRSKVRKAMPEVFRFVIDELLHAQPDEDQNQLVYHMKILDTILETGS
TRQFIYALANLIKRLAVDHLHIIGDIYDRGAHADKIMDTLMHHHSLDIQWGNHDVLWMGA
AAGNAACIANVLRNNIRYHNMEILESGYGISLRPFALFALDTYKQDDGMEPMVKAINVIV
AKLEGQTIYRHPDYNMDDRLLFHKIDWEKGVITLGGKTYELKTKDFPTVNPQDPYTLSPE
EHQLMNDIQVEFTESERLQRHIRFLYSHGSLYRCMNNNLLFHGGLPLNEDGSFKEIYLDG
KPYKGKAFMDKAEHLIRRAYDQRDTDSLDYMWYLWCGADSPVSGRIVKTFERSYIIDEST
WKEPQNAYYRLNRDKDECIKILHEFGIDSPQGHIINGHTPVKVKKGESPIRAEGKEICID
GGFCKAYQGSTGIAGYTLIFNSHGIRIKSHYPFEDVYQALMNNVDIDSESTQVELEPKRV
MIGDTDNGKKLLQMIRDLKALLEAYRQGVILERRPNP
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgtacgatacttattctcccgaatatctgcgctatttggagctcttgtccaag
gagtatccgacacaggctgcgacgtttacagaaatcatcaacctgcaggcgattgtcaat
ctgcccaaggggacggaacacttcatgagtgacctgcacggcgaatatgaagccttttat
cacatcctgaacaactgctccggcgtcatccgggaaaaagtagaaatgattttttctgac
aagatgagcaaggccgaacaagatgacttattgacgctcatttactatccgaaagaaaaa
ctgaacatgctataccgagaaggcaaggtcaacgatgactgggcccggacgacgctggaa
cggatgatcgacctggccaagctcttgtcttcgaagtacacgcggtcgaaggtccgtaaa
gccatgccggaagtcttccgcttcgtcatcgatgaactcttgcatgcccagcccgatgaa
gaccagaatcagctggtctaccatatgaaaatcctcgataccatcttagaaacgggcagt
acgcggcaattcatctacgctttggccaatctcatcaaacgcctggctgtcgatcacttg
cacatcatcggcgatatttacgaccgcggcgctcatgccgataagatcatggataccctc
atgcaccatcattccctggacatccagtggggcaaccacgacgtcctttggatgggggcc
gctgccggcaatgccgcctgcatcgccaatgtcctgcgcaataacatccgttaccataat
atggaaatattagaaagcggttatggcatcagcctgcgcccctttgccctgttcgccttg
gatacgtataaacaggacgacggcatggaaccgatggtcaaggccatcaacgtcatcgtg
gctaaactggaaggccagacgatttaccgtcatcccgactataatatggacgaccgcctg
ttgttccataaaatcgattgggaaaaaggcgtcatcaccctcggtggcaagacgtatgaa
ctgaagaccaaagatttcccgaccgtcaacccgcaggacccgtatacactgtcgccggaa
gaacatcagctcatgaatgacatccaggttgaatttaccgaaagcgaacgccttcagcgc
catatccgcttcctctacagccacggttctttataccgctgcatgaataacaacctcttg
ttccacggcggcctgccccttaatgaagacggcagtttcaaggaaatctacctcgacggc
aagccgtataagggcaaggcattcatggataaagcggaacacctcatccgccgggcttac
gaccagcgcgatacggacagcctggattatatgtggtatctctggtgcggtgctgattct
cccgtatccggccgtatcgtcaagacttttgaacggagttacatcatcgatgaatcgacg
tggaaagagccgcagaatgcttactaccgcctgaatcgcgataaagatgaatgtatcaag
atccttcacgaatttggcatcgactcgccccaaggccacatcatcaatggccatacgccg
gtcaaggtcaagaaaggcgaaagcccaatccgtgcggaaggcaaggaaatctgcatcgac
ggcggtttctgcaaagcttatcagggctctacgggcattgccggttacacgctcatcttc
aactcccatggtatccgcatcaaatcccactatccctttgaagacgtctatcaggccctc
atgaacaatgtcgacatcgattccgaatcgacacaggtcgaattggaaccgaagcgggtc
atgatcggcgacacggataacggtaagaaactcctgcagatgatccgcgacttgaaggct
ctcttggaagcctatcgtcaaggcgtcatccttgaacgtcgcccgaatccgtag

DBGET integrated database retrieval system