KEGG   Megasphaera elsdenii: MELS_1163Help
Entry
MELS_1163         CDS       T01633                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
med  Megasphaera elsdenii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:med00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:med00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1288208..1289713
Genome map
AA seq 501 aa AA seqDB search
MTKTVGELCKQIKGIYNLNGSADTVITGISSDSRQIEAGYLFVCISGVHVDGAAFAAQAV
EKGAVAVLTTKHLDLPKSTVQIQVPDIHHALEDMVPFFYDYPGKKMRMIGVTGTNGKTTT
THIIAHILRAAGYHVGVIGTIHALIDDEELPIHNTTPDVVELQHFLALMQEKGMTHVVME
VSSHALALNRVAGIEYDTAVFTNLTQDHLDFHKTMENYVAAKAKLFQSLTAADHVKENKT
AVVNIDDPWSKDILNACHCKVLTYGVEKDADLKGSNLKVELKKSSFDVVGPFVNVHLNMN
ITGLFNVYNTLAAIGAAHAEGVDEATIDKAIQTFHSVPGRFELVEAGQDFAIVVDYSHTP
DSLQKALETARAMKPNRILAVFGCGGDRDKTKRPIMGRIGAELADIPIVTSDNPRSENPE
TIVEEVEAGVKEGLKPGQHHEVIVNRRDAIYRAVELAQTNDIIVIAGKGHETYQILNDGT
IHFDDREEARNAVHALHRGDK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaacggtaggagaactttgcaaacagatcaaaggcatttataatctcaacggc
agtgccgatacagtgattaccggtatttcgtcggattcacgccagattgaagccggctat
ctcttcgtctgcatttccggtgtccacgtcgatggcgccgcttttgcagcccaggctgtc
gaaaaaggggccgtcgccgtcttgacgacgaaacacctggatttgcccaagagcacggtc
cagatccaggtaccggatattcatcatgccctggaagacatggttcctttcttttatgat
tatcccggcaagaagatgcgcatgatcggtgtcaccggcaccaacggcaagacaacgacg
acccacatcatcgcccatatcctgcgggctgccggctaccatgtcggcgtcatcggcacg
atccatgccctcatcgacgatgaagagctgccgatccacaacacgacgccggatgtcgtc
gaactccagcatttcctggccctcatgcaggaaaaaggcatgacccatgtcgtcatggaa
gtatcgagccatgccctggctctgaaccgcgtcgccggcatcgaatacgatacggctgtc
ttcaccaacctgacccaggaccatctcgacttccacaagaccatggaaaactacgtcgct
gccaaggctaaactcttccagagcctgaccgctgccgaccacgtcaaggaaaacaagacg
gctgtcgtcaacatcgacgacccctggtccaaggatatcctcaatgcctgccactgcaag
gtcttgacgtatggcgtcgaaaaggatgccgacctcaaagggtccaacttgaaagtcgaa
ttgaagaaatcctctttcgacgtcgtcggccccttcgtcaatgtccatctcaacatgaac
attacgggcttgttcaacgtctataatacgctggctgccatcggcgcggctcatgccgaa
ggtgtcgatgaagcgaccatcgacaaggccatccagaccttccattccgtaccgggccgt
tttgaactcgtcgaagccggtcaggatttcgccatcgtcgtcgactattcccatacgccg
gacagcctgcagaaagccctggaaacggcgcgggctatgaaaccgaaccgcatccttgcc
gtctttggctgcggcggcgaccgcgataagaccaagcgtcccatcatgggccgcatcggg
gccgaactggccgatatccctatcgtcacgtccgataatccccgttcggaaaatccggaa
accatcgtagaagaagtcgaagccggcgtcaaagaaggtctgaagccgggccagcaccat
gaagtcatcgtcaaccgccgcgacgccatttaccgcgctgtcgaactggcccagaccaat
gacatcatcgtcattgccggtaaaggccatgaaacgtatcagatcctcaatgacgggacc
attcatttcgacgaccgcgaagaagcgcgcaacgccgtccatgcattgcacagaggagat
aaataa

DBGET integrated database retrieval system