KEGG   Megasphaera elsdenii: MELS_1219Help
Entry
MELS_1219         CDS       T01633                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
med  Megasphaera elsdenii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MELS_1219
   00052 Galactose metabolism
    MELS_1219
   00500 Starch and sucrose metabolism
    MELS_1219
   00520 Amino sugar and nucleotide sugar metabolism
    MELS_1219
Enzymes [BR:med01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MELS_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1352517..1353392
Genome map
AA seq 291 aa AA seqDB search
MKKIRKAVIPAAGFGTRFLPATKATPKEMLPIVDKPTIQYIVEEALQSGIEEILIISGHA
KRAIEDHFDTNPGLELHLEESHKMGLLNMVRSISEINIHYIRQKHMRGLGDAILCAQSFI
ADEPFAILLGDDVVYNETNPALRQMIDLYNDLDATILGCQEVPLEKVSSYGIVQGTPVEG
QGILKVNRVVEKPAIEEAPSRTAVLGRYIVTPDIFEVLSHTRPGKGGEIQLTDALQTMAS
REAVYAYCFEGKRYDVGDKLGFLKANVEYALRRPDLAAPFRQFLKEVVRGS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaatccgtaaagccgtcatcccggcggccgggttcggcacccgtttcctgccg
gcgacgaaggcgacgccgaaagaaatgctgcctatcgtcgataagccgacaatccagtat
atcgtcgaagaagccctgcagagcggcatcgaagaaatcctcatcatcagcggccatgcc
aaacgggccattgaagaccacttcgataccaatccgggcctggaactgcacctggaagaa
agccataagatggggcttttgaacatggtccgcagtatttccgaaatcaatatccactat
atccgtcagaaacacatgcggggcttaggcgatgctatcctttgcgcccagtccttcatt
gctgacgaacccttcgctatccttctcggcgacgacgtcgtctacaacgaaaccaatccg
gccctgcgccagatgatcgatttgtacaacgacctcgacgcgaccatcctgggctgccag
gaagtccccttggaaaaagtatcgtcttacggcatcgtccaggggacgcctgtcgaaggg
cagggcatcctcaaggtcaaccgcgtcgtcgaaaagccggccatcgaagaagcgccgagc
cggaccgccgtcctcggccgttatatcgtcacgccggacatctttgaagtcctgtcccat
acccggccgggcaaaggcggggaaatccagctcaccgatgccttgcagaccatggccagc
cgggaagcggtctatgcctactgctttgaaggcaagcgctacgacgtcggcgataaactg
ggctttttgaaagccaacgtagaatacgccctgcgccggcccgacctggccgccccgttc
cgccagttcctgaaggaagtcgttcgtggttcgtag

DBGET integrated database retrieval system