KEGG   Megasphaera elsdenii: MELS_1245Help
Entry
MELS_1245         CDS       T01633                                 

Definition
holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
med  Megasphaera elsdenii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:med00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MELS_1245
Enzymes [BR:med01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MELS_1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1376319..1376924
Genome map
AA seq 201 aa AA seqDB search
MIGYLKGVISHLFVNSCFIDVHGVGYRAYAPASTLDTLCVGQEAMLYTYMSVREDAIVLY
GFATQDEYDLFMLLIGVNGVGPKVALGILSAGTADSFRLAVHQKDIKGLTKMPGIGKKTA
ERIVLELQDKIGPVAGGEAAAVEGGSSSAGLSGILAETLAALTSLGYSEQEVLPVAESHL
AGCTTVEQLLKETLKALGSGR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatatctgaaaggcgtgatcagccacctcttcgtcaattcctgcttcatcgac
gtccacggtgtcggctaccgggcttatgcaccggcttcgacactggacacgctctgtgtc
ggtcaggaagccatgctctatacgtacatgagcgtccgcgaagacgccatcgtcttatac
ggctttgctacgcaggatgaatacgatttgttcatgctcctcatcggcgtcaacggcgtc
ggcccgaaagtggccctgggcatcctcagtgccggcacggccgacagtttccgcctggcc
gtccatcagaaggacatcaaaggtttgaccaagatgcccggtatcggcaagaagacggcc
gaacgcatcgttctggaattacaggataaaatcggccccgtcgccggcggagaagcggca
gctgttgagggcggttcgtcttcggcaggcttgtcgggtatcctggcggaaaccctggcg
gccctgaccagtctcggctacagcgaacaggaagtcctgcccgtcgccgaatcgcacctg
gccggctgcacgacagtggaacagctgctgaaagagacgctgaaggccttggggagcggg
aggtaa

DBGET integrated database retrieval system