KEGG   Megasphaera elsdenii: MELS_1305Help
Entry
MELS_1305         CDS       T01633                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
med  Megasphaera elsdenii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:med00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1442080..1443489
Genome map
AA seq 469 aa AA seqDB search
MFPENFLWGGAVAANQLEGAYDEGGKGLSIQDVLPQGLKGPRTAGPTPDNLKLKGIDFYH
RYKEDIRLFAELGFKVFRTSIAWSRIFPRGDEKEPNEAGLVFYDDLFDECHKYGIEPLVT
ISHYETPLYLADHYGGWTNRKLIGFYENYVRTIFTRYQHKVKYWLTFNEINSILGSPFMS
GAIPTPKEELSASDLYQAIHHELVASARAVKIGHEINPAFQIGCMVLAMPSYPLTPQPTD
VIAAMELNHQNELFLEVQARGRYPGYAQRYFREKGIHLDIRPDERELLQENTVDFISLSY
YVSTCAAADSTAADAAGDLFTGVTNPYLPSSAWGWQIDPQGLRFVLNTFWDKFQKPLFVV
ENGLGAKDELVFDDEKGQWTVEDDYRIDYLQQHLLAVEEALADGIPVLGYTIWGCIDLVS
ASTAQMSKRYGVIYVDRHDDGRGSLARYRKKSFYWYQKVIASNGVALHD
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctgaaaattttctttggggcggcgctgtggctgccaatcagctggaaggggct
tatgatgaaggcggcaagggcctttcgattcaggatgtcctgccgcagggactgaagggg
ccgcgcacggccgggccgacaccggacaatttaaaattgaaaggcattgatttttatcat
cgttataaagaagatatccgcctctttgcggaactgggcttcaaggtcttccgcacgtcc
atcgcctggagccggatttttccgcgcggcgacgaaaaagagccgaatgaagcgggcctg
gttttttacgatgacctcttcgatgaatgtcataagtacggcatcgagcctttggtgacg
atttcccactatgaaacgcccctctatctggccgaccattacggcggctggacgaaccgc
aagctcatcggcttttacgaaaactacgtccgcacgatttttacgcgctatcagcataag
gtcaagtactggctgactttcaatgaaatcaattcaattctgggctcgcccttcatgagc
ggcgccatcccgacgccaaaagaggaactcagcgcaagtgacctctatcaggccatccac
catgagctcgtggccagcgccagagccgtaaaaatcggtcacgaaatcaacccggctttt
cagatcggttgcatggtcctggccatgcccagttatcctttgacaccgcagccgactgat
gtcatcgcggccatggagctcaaccaccagaatgagctcttcctcgaagtccaggcccgc
ggccgctatccgggctatgcccagcgctatttcagggaaaagggaatccatctcgatatc
cgtccggacgaaagggaactgctgcaggaaaatacggtcgattttatttccctgagctat
tatgtcagtacctgtgcggccgccgacagcacggccgcagatgcggcaggcgacctcttt
acgggcgtgaccaatccgtatttgccgtcatcggcctggggctggcagatcgacccgcag
ggcctgcgctttgtcctcaatacgttctgggataaattccaaaagcccctcttcgtcgtc
gaaaatgggctcggtgcgaaggacgagctcgtctttgacgacgaaaaggggcagtggacc
gtcgaggacgattaccgcatcgattatttgcagcagcatctcttggccgtagaagaagcc
ttagccgacggcatccccgtcctcggctacaccatctggggctgcatcgatctggtcagc
gcctcgacggcgcagatgagcaagcgttacggcgtcatttacgtcgaccgccatgacgac
ggcaggggcagcctggcccgctatcggaagaaatccttttactggtaccaaaaggttatc
gccagcaacggcgtggccctgcacgactaa

DBGET integrated database retrieval system