KEGG   Megasphaera elsdenii: MELS_1376Help
Entry
MELS_1376         CDS       T01633                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
med  Megasphaera elsdenii
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:med00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MELS_1376
Enzymes [BR:med01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     MELS_1376
Amino acid related enzymes [BR:med01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   MELS_1376
Transfer RNA biogenesis [BR:med03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MELS_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1513658..1515112
Genome map
AA seq 484 aa AA seqDB search
MSQEVRVRFAPSPTGPFHIGGARSALFNYLVAKHNHGKFVVRIEDTDRKRSTSESEENIK
EALKWLGINWDEGIDVGGPNGPYRQTERLDIYKKYTEKLLAEGKAYYCFCTPEELEAEKQ
AQLAKGETPVYSGKCADLPKETVEQYLREGRPHVIRIKTPKNETIELDDLVRGHVSFDSN
NVGDFVIVKSDGIPVYNYCVVLDDALMHITHVIRAEEHLSNTPRQLVIYKALGFEAPKFA
HVSLILGADKKKMSKRHGATSVQQYRDMGYLPDALVNFLALLGWTPDGDQEIFSRDELIE
QFTLDRVAKNPAVFDIEKLNWINFHYMKQLDEDQLYAVCLPHLQKAGYASETPDETEAAW
LKSVCAAMREHVQYGAQIVDAAKVFFTDDYAPENEETAAVLKEETAPSVLKMFRDELAAL
DDVTPDTVQPLFKKIQKGLKVKGKFVYMPIRVAVTGVMHGPDLNVIVALMGRDKVLQRLD
KICG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggaagtacgcgttcgttttgctccgagcccgacaggcccgttccacatcggt
ggtgcccgttcggcactgttcaactacctcgttgccaagcacaaccacggtaagttcgtc
gtccgcatcgaagatacggaccgcaagcgttcgacgtcggaatcagaagaaaatatcaag
gaagccctgaaatggctgggcatcaactgggatgaaggcatcgatgtcggcggcccgaac
ggcccgtaccgccagacggaacgcctggacatctacaagaaatatacggaaaagctctta
gctgaaggcaaggcttattactgtttctgtacgccagaagaactggaagcagaaaaacag
gctcagctggccaagggcgaaacgccggtctactccggcaaatgtgccgacctgcccaag
gaaacggtcgaacagtacctcagggaaggccgtccccatgtcatccgtatcaagacgccg
aagaacgaaacgattgaactggacgacctcgtccgcggccacgtatccttcgactccaac
aatgtcggcgacttcgtcatcgtcaaatccgacggcatcccggtctataactactgtgtc
gtcctcgacgatgccctgatgcacatcacccacgtcatccgcgcggaagaacatctttcc
aacacgccgcgccagctcgtcatctacaaggccctgggcttcgaagcaccgaagttcgcc
cacgtctcgctgatcctcggcgccgacaagaagaagatgagcaagcgccacggcgccacc
tcggtccagcagtaccgcgacatgggctatttgcctgatgccctggtcaacttcctggct
ctcctcggctggacgcccgatggcgatcaggaaatcttcagccgcgacgaactcatcgaa
cagttcaccctcgaccgcgtcgccaagaacccggccgtattcgacatcgaaaaattgaac
tggattaacttccattatatgaagcagctcgatgaagaccagctttatgccgtctgcctg
ccgcacctgcagaaggccggctatgccagcgaaacgccagatgaaacggaagccgcttgg
ctgaaatccgtctgcgcggctatgcgcgaacacgtccagtacggcgctcagattgtcgat
gctgccaaggtcttcttcaccgacgactacgcaccggaaaatgaagaaacggcagctgtc
ctcaaagaagaaacggctccgtccgtcctcaagatgttccgcgatgaactggctgccctc
gacgacgtcacgcccgacacggtacagcccctgttcaagaaaatccagaagggcctcaag
gtcaaaggcaagttcgtctacatgcccatccgcgtcgccgtcaccggtgtcatgcacggc
ccggatctgaacgtcatcgtcgccctcatgggccgcgacaaggtcctccagcgcctcgat
aagatttgcggataa

DBGET integrated database retrieval system