KEGG   Megasphaera elsdenii: MELS_1412Help
Entry
MELS_1412         CDS       T01633                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
med  Megasphaera elsdenii
Pathway
med00670  One carbon pool by folate
med00790  Folate biosynthesis
med01100  Metabolic pathways
Module
med_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MELS_1412
   00670 One carbon pool by folate
    MELS_1412
Enzymes [BR:med01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MELS_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CCC73633
UniProt: G0VQA5
Position
1551961..1552458
Genome map
AA seq 165 aa AA seqDB search
MLHLIAAVDKRGGIGKDNDLLCHISADLKRFKSLTMGHTMIMGRKTFESLPGVLPGRPHW
VLTHQKDYDVRHEAVTVFHSVEALQQAMNDGEDYFVIGGAAMYREFLPLADSLYLTEIDE
AFDGADTFFPDWDRSAWTEQTRELHRADGQCPHTFSFVHYVRRFD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgctccatctcattgcagccgtcgacaagcgcggcgggatcggtaaggataacgacctc
ttgtgccatatttcggctgacttaaaacgttttaaatctctcactatgggccatacgatg
atcatgggacgcaagacctttgaaagcctgcccggcgtcttgcccggccggccgcactgg
gtcctgacccatcaaaaagattatgacgtccgccatgaagcggtcactgtcttccatagc
gtcgaagccctgcagcaggccatgaacgatggggaagactacttcgtcatcggcggcgct
gccatgtaccgggaatttctgcccctggcggacagcctctacctgacggaaatcgacgaa
gccttcgacggcgccgacacctttttcccggactgggatagaagcgcctggacggaacaa
acgcgggaattgcaccgtgccgatggacagtgtccccatactttttctttcgtccactat
gtccgccgtttcgattga

DBGET integrated database retrieval system