KEGG   Megasphaera elsdenii: MELS_1583Help
Entry
MELS_1583         CDS       T01633                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
med  Megasphaera elsdenii
Pathway
med00260  Glycine, serine and threonine metabolism
med00750  Vitamin B6 metabolism
med01100  Metabolic pathways
med01110  Biosynthesis of secondary metabolites
med01120  Microbial metabolism in diverse environments
med01230  Biosynthesis of amino acids
Module
med_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MELS_1583
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MELS_1583
Enzymes [BR:med01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MELS_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Ntox44
Motif
Other DBs
NCBI-ProteinID: CCC73803
UniProt: G0VQV3
Position
1740181..1741683
Genome map
AA seq 500 aa AA seqDB search
MNFRSTRSDECVSPSYALLHGLAADGGLYVPESFPENVLSYKDLAGKSYQDIAEAVLSHF
FTNFTAEERKQMIASAYNDTTFRDDRIVPLHSIDTDLSIAELFHGRTLAFKDLALSLFPY
LLTAAKKQEKEDRDILILTATSGDTGKAALEGFKDVPGTNIMVFYPSEGVSPMQKQQMQK
QEGDNVKVSAIYGNFDDAQSFLKRVFTSAEVNAYANEKGVLFSSANSINIGRLFPQVAYY
VSTYVSLVDNGAISEGETFDVIVPTGNFGNILAGYFAKKMGIPIGKLICASNQNKVLADF
FETGVYDMNRDFYTTSSPSMDILLSSNFERFLFYVAGQNAQKVAQWEKDLLETGKMSVSE
AELKTLRQEFEGGWIDDDETKAVINHVYNDFGYLLDPHTAVAYGVGMNRHRQGLDEGRHT
VVMATAHPYKFPPVICEALALRQSDDPFDMLADISSVTGIALPKPLADLKDKPVRFSDSI
DKEDMKKAVLAFVDAIAAKH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaattttagaagtacacgatctgacgaatgtgtttcgccgtcttatgcactcttgcat
gggctggctgctgacggaggcctttatgtaccggaatcattcccggaaaatgtcctgtct
tataaagacctggccggcaaatcctatcaggacatcgctgaagccgtcttgtcccatttc
tttacgaatttcacggcggaagaacggaagcagatgatcgcttcggcctacaatgatacg
actttccgcgatgaccgcatcgtaccgctccattccatcgatacggatttgtccattgcc
gaactgttccacggccggacgctggccttcaaggacctggccctgtcgttgttcccgtac
ttgctgacggcggccaagaagcaggaaaaagaagaccgggatatccttatcctgacggcg
accagcggcgacacgggtaaagccgccctggaagggttcaaagatgtacccggtacgaat
atcatggtcttttatcccagcgaaggcgtcagccccatgcagaagcagcagatgcagaag
caggaaggggacaatgtcaaggtttcggccatttacggcaatttcgacgacgctcagagc
ttcttgaaacgcgttttcaccagcgccgaagtcaatgcctatgccaacgaaaaaggcgtc
ctcttctccagcgccaactccatcaacatcggccgcttgttcccgcaggtcgcttactat
gtatcgacgtatgtctccctcgtcgataatggcgccatcagcgaaggcgaaacattcgac
gtcatcgtcccgacagggaatttcggcaatatcctggccggctatttcgccaagaaaatg
ggcatccccattggcaaactgatctgtgcatccaatcagaacaaggtcctggccgacttc
tttgaaaccggcgtctacgatatgaaccgcgatttctatacgacgtcgagcccgtctatg
gacatcctcttgtcgagcaactttgaacgcttcttgttctacgtcgccggccagaatgcc
caaaaggtcgcccagtgggaaaaagacctgctggaaacggggaagatgagcgtttcggaa
gcggaattgaagaccctccgccaggaatttgaaggcggctggatcgacgatgacgaaacg
aaggccgtcatcaaccacgtctacaatgattttggctatctcctcgatccccatacggcg
gtcgcttacggcgtcggcatgaaccgccaccgccagggcctggacgaaggccgccacact
gtcgtcatggcgacggctcatccctataaattcccgccggtcatctgcgaagccctggcc
ctgcgccagagcgatgatcccttcgacatgctggccgacatcagcagcgtcacgggcatt
gccctgcccaagcccctggctgatctcaaggacaaaccggtccgtttcagcgattccatc
gacaaagaagacatgaagaaagccgtcctggcttttgtcgacgccattgctgccaagcac
tag

DBGET integrated database retrieval system