KEGG   Megasphaera elsdenii: MELS_1602Help
Entry
MELS_1602         CDS       T01633                                 

Definition
helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
med  Megasphaera elsdenii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:med00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MELS_1602
Enzymes [BR:med01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MELS_1602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1765324..1767489
Genome map
AA seq 721 aa AA seqDB search
MKMEQIVVRGIAERLLFEAPDSDYRVFRLHDEADDATYTVTGHGTKPLVGDRLEIKGHWV
QHKRYGRQFAADGWSRIIPESVDGIERFLGSGAVKGLGPALAHRVVAAFGKDTMKILERD
PQRLLEVEGIGPKKLAVITESFYEEKQVNDIAYDLEQHGVAGRYAGRLLQKYGDDVHYVL
TEEPYRMIAEIDGIGFKTADQMALAYGMDRQDPQRLSAGLTYVLQTMTQNGHVCIPDAEL
VRRAAFILQADALGLHDILKEAIEVGQLCTADFQGTVYVYTPEAYEEENYIARRIQDMAA
MKPLPMKTHVQLFLDRWQDSCHFELADKQREAVEKSLESGMTVITGGPGTGKTTVVQTII
RLAEQEGLRILLCAPTGRAAKRLAETTQRKAKTIHRLLIPDGRQGRIQVFEYNETKLLPA
DLVIVDEVSMLDMEMMYHLLSALKPQCRCILVGDADQLPSVGAGAVLHDIIASGQVPVVR
LDTIFRQQEGGRIVTNAHLINSGRLPVVNEDPEFRFVEIEDEAQGAEKISALYNSELLET
GDKFAVQVLSPMYKNPCGVDNLNQLIQGRFNPPAEGKGELKGKNVIFRVGDKVMQKHNDY
EKGVFNGDIGEIFAIQKDMVYVRYPEQDVKYEGQEVDEITLAYAITVHKSQGSEYHTVIM
VLVNSHAIMLQRNLFYTAVTRAKRKVILVGSKRAVQTAVQNQRTSRRFTLLIPRLQGELI
V
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatggaacagattgtagtacgaggcattgcggaacgcctcttatttgaagcgccc
gactcggattaccgcgtcttccgccttcatgacgaagccgacgacgcgacgtataccgtc
accggccatgggacgaaacctcttgtcggcgaccgcctggaaatcaagggccactgggtc
cagcataagcgctatggccgccagttcgccgccgacggctggagccgcatcatccctgaa
tcggtcgacggcatcgaacgcttcctgggaagcggtgccgtcaagggactggggccggcc
ctggcccaccgcgtcgtcgcggcctttggcaaggacacgatgaagatattggaaagggac
ccgcagcggctcctggaagtcgaaggcattggcccgaagaaactggccgtcattacggag
tcattctacgaagagaaacaggtcaacgacatcgcctacgacctggaacagcatggcgtc
gccgggcgctacgccggcaggctcttgcagaaatacggtgacgacgtccactatgtcctg
acggaagaaccgtaccgcatgatcgccgaaatcgacggcatcggtttcaagacggccgac
cagatggccctggcctatggcatggaccggcaggacccgcagcgcctcagcgccggcctg
acctatgtcttgcagaccatgacccagaacggccacgtctgcatccccgatgcggaattg
gtccgccgggcggctttcatcttacaggccgatgccctggggctgcacgatatcctgaag
gaagcgatcgaagtgggccagctctgtacggccgatttccaggggaccgtctatgtctat
acgccggaagcctatgaagaagaaaattatattgcccggcgtatccaggacatggcagcc
atgaagcccctgcccatgaagacccatgtccagctcttcctcgaccgctggcaggattcg
tgccattttgaactggccgataagcagcgcgaagccgtcgaaaaatcgctggaatcgggc
atgacggtcatcaccggcggtcccgggacgggcaagacgactgtcgtccagaccatcatc
cgcctggccgaacaggaagggctgcgtatcctcctctgtgcgccgaccgggcgggccgcc
aagcgcctggccgaaacgacgcagcgcaaggccaagaccattcaccgtctgctcatcccc
gacggtcgtcagggacggatccaggtctttgaatacaacgaaaccaagctgctgccggcc
gacctggtcatcgtcgatgaagtctctatgctcgacatggaaatgatgtaccatctcctc
agtgccttgaaaccgcagtgccgctgcatcctcgtcggcgacgccgatcagctgccgtcg
gtcggggccggtgccgtcctgcatgacatcatcgcctcgggacaggtcccggtcgtccgc
ctggatacgattttccgtcagcaagaaggcgggcgtatcgtgaccaatgcccacctcatc
aacagcggccgtctgcccgtcgtcaatgaagacccggaatttcgcttcgttgaaatcgaa
gacgaagcccagggggccgagaagataagcgccctctataacagcgagctcctggaaacg
ggggataagttcgccgtccaggttctgtcgccgatgtacaagaacccttgcggcgtcgac
aacctcaatcagctcatccaggggcggttcaacccgccggctgaaggaaaaggcgagctg
aaggggaagaacgtgattttccgcgtcggagacaaggtcatgcagaagcacaatgactat
gaaaaaggcgtcttcaacggtgatataggggaaatctttgccatccagaaggatatggtc
tatgtccgctatcccgaacaggacgtcaagtacgaagggcaggaagtcgatgagattacc
ctggcctatgccattaccgtccacaagagccagggcagcgaataccacacggtcatcatg
gtcctggtcaacagccatgccatcatgctccagcgtaatctcttttatacggccgtcacc
cgggccaagcggaaagtcatcctcgtcggcagcaagcgggctgtccagactgccgtccag
aaccagcgcacgagccgccgcttcacgctgctcattccgcgcctgcaaggagagctcatc
gtctag

DBGET integrated database retrieval system