KEGG   Megasphaera elsdenii: MELS_1767Help
Entry
MELS_1767         CDS       T01633                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
med  Megasphaera elsdenii
Pathway
med00230  Purine metabolism
med01100  Metabolic pathways
Module
med_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MELS_1767
Enzymes [BR:med01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MELS_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 AAA_17 AAA_22 AAA_16 AAA_33 ADK ABC_tran Cytidylate_kin Thymidylate_kin AAA_30 AAA_28 AAA_29 T2SSE ATP_bind_1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CCC73986
UniProt: G0VRU6
Position
complement(1935900..1936514)
Genome map
AA seq 204 aa AA seqDB search
MNDSGLLIVVSGPSGAGKGTICSALREQFPNIQYSISMTTRKPRPGEVDGVNYYFADNAR
FEQLLAEDAFLEHAKVYDHYYGTPKKYVYQMLEEGKHVMLEIDIQGAMQVKKRYPQGVFI
YIVPPSRDVLEKRLRGRQTDSDDVIAGRLAKARAELDWIDRYDYVIVNDELEKAVDEAAS
ILKAEQCKVTRNAHRIAHTKELYK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattccggattgctcatcgttgtgtccggcccgtccggagccggcaaggggacg
atttgttccgctctgcgggaacagttcccgaatatccaatattctatttccatgacgacc
cgaaaaccccgtcctggggaagtggacggcgtcaattattattttgccgataacgcgcgg
ttcgagcagctcctggcagaagatgccttcctggaacatgccaaggtctacgaccattac
tacggcacgccgaagaagtacgtttatcagatgctggaagaaggcaaacacgtcatgctg
gaaatcgacatccaaggggccatgcaggtcaagaaacggtatccccaaggcgtcttcatc
tacatcgtaccgcccagccgggacgtcctggaaaaacgcctccgcggccgtcagaccgat
tcggacgacgtcatcgccggccggctggccaaggcccgggcagaactggactggatcgac
cgctatgattacgtcatcgtcaacgacgaactagagaaagccgtcgatgaagcggcgtcc
atcttgaaagccgaacagtgtaaagtgacgcgcaatgcccatcgcatcgcccatacgaaa
gaattgtacaaataa

DBGET integrated database retrieval system