KEGG   Megasphaera elsdenii: MELS_1779Help
Entry
MELS_1779         CDS       T01633                                 

Definition
(RefSeq) L-ribulose-5-phosphate 4-epimerase
  KO
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
med  Megasphaera elsdenii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MELS_1779
Enzymes [BR:med01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MELS_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1953102..1953734)
Genome map
AA seq 210 aa AA seqDB search
MDTKKTLCRIGTQMKEAGLVTACDGNISFRRSDGAIVITPSGVPKGELKPKHLLVVDLDG
HVLEGTGKASSESSLHLEIYRKREDIKAIIHAHPITATALTVAGIPFRPDIVTEGALVLG
PVPTVPYAPPGSEALALACAEAAEGADVFLMERHGAATVGQNLTQAFYRLETLETVAKMY
RDSLIFAAAKDSQNNNPAAKAQPLSWYLKK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggataccaagaaaacactgtgccgcatcggcacccagatgaaagaagccggcctggtc
acggcctgcgatggcaatatcagtttccgccgcagcgacggggccatcgtcattacgccg
tcaggcgtgccgaaaggagagctgaagcccaagcacctgctcgtcgtcgacctcgacggc
catgtcctggaagggacggggaaggcgtcgtccgaatcgtccctccatttggaaatttat
cggaagcgagaggacataaaggccatcatccacgcccatcccatcacggcaacggccctg
accgtagccggcatccccttccggccagacatcgtcaccgaaggagccctggtcctggga
ccggtgccgaccgtaccctatgcgccgccgggatcggaagccctggccctggcctgtgcc
gaagccgcagaaggagcagatgtcttcctcatggaacgtcacggcgctgccaccgtcggc
caaaatctgacccaggccttttaccgcctggaaaccttagagaccgtagccaagatgtat
cgtgattctctcatcttcgccgccgctaaggactcgcaaaacaataaccccgctgccaaa
gcccagccattgagctggtacttgaaaaaataa

DBGET integrated database retrieval system