KEGG   Megasphaera elsdenii: MELS_1870Help
Entry
MELS_1870         CDS       T01633                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
med  Megasphaera elsdenii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MELS_1870
Enzymes [BR:med01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MELS_1870
Exosome [BR:med04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MELS_1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2056223..2057212
Genome map
AA seq 329 aa AA seqDB search
MKLNTLRPRRLRLSAPLRAMVRENHVCLNDLIYPIFVVPGTNVKEEIPSMPGCYHLSVDN
AVRLAEDIYALGLRAIEVFGLPAYKDEIGSSAWDPQSPVQCAIRAIKKALPDMVIVGDVC
LCQYTDHGHCGQIKDHYVDNDATLKLLNKVAVSQAEAGADIVAPSDMMDGHIASIRQALD
EEGFINTIIMSYAAKYASGFYGPFRDAADSAPHFGDRRQYQMDPANGREAMKEIDLDLEE
GADIIMVKPALSYLDIVYQARQRCQRPIATYNVSGEYAMVKAAARNGWIDEKRIVMEELT
SMKRAGADIIITYHAVDVAKWLKNDEVEA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaataccttacgcccccgccgcctgcgcctttccgctcccctgcgcgctatg
gtccgggaaaaccatgtatgcctcaacgatttgatttaccctatcttcgtcgtccccggc
acgaatgtcaaagaagaaatccccagcatgcccggctgttatcacctgtccgtagacaac
gccgtccgcctggccgaagacatctatgccttagggctgcgggccatcgaagtcttcggc
ctgccggcttacaaagacgaaatcggttccagcgcctgggacccgcaaagcccggtccag
tgcgccatccgggccatcaagaaagccctgccggacatggtcatcgtcggtgacgtctgc
ctctgccagtacaccgaccacggtcactgcggccagatcaaagaccactacgtcgataac
gacgccacgctgaaactgctcaacaaagtcgccgtcagtcaggccgaagccggtgccgac
atcgtcgccccgtcggacatgatggacggccacatcgcctccatccgccaggccttggat
gaagaaggcttcatcaacaccatcatcatgtcctatgccgccaaatatgcctccggcttc
tacggtcccttccgcgacgccgccgattcggcaccgcacttcggcgaccgccgccagtat
cagatggacccggccaacggccgcgaagccatgaaggaaatcgacctcgacctggaagaa
ggcgccgacatcatcatggtcaagccggccctgtcctacctggacatcgtctaccaggcc
cgccagcgctgccagcggcccattgccacgtacaacgtcagcggcgaatacgccatggtc
aaagcggctgcccgcaatggctggatcgacgaaaagcgcatcgtcatggaagaattgacc
agcatgaagcgcgccggtgcggacatcatcatcacctaccacgccgtcgacgtcgctaag
tggctgaagaacgacgaagtcgaggcctaa

DBGET integrated database retrieval system