KEGG   Megasphaera elsdenii: MELS_1875Help
Entry
MELS_1875         CDS       T01633                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
med  Megasphaera elsdenii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MELS_1875
   01230 Biosynthesis of amino acids
    MELS_1875
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MELS_1875
   00030 Pentose phosphate pathway
    MELS_1875
   00051 Fructose and mannose metabolism
    MELS_1875
   00052 Galactose metabolism
    MELS_1875
  Energy metabolism
   00680 Methane metabolism
    MELS_1875
Enzymes [BR:med01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MELS_1875
Protein phosphatases and associated proteins [BR:med01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MELS_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2061747..2062709)
Genome map
AA seq 320 aa AA seqDB search
MINKIGVLTSGGDAPGMNAAIRGVTRYAIQKGLTVEGIIRGYEGLLSHETRPLGRRDVGA
IIHRGGTMLRTARCLEFKEKETQKKAAAYLRELEIDALVVIGGDGSMRGAQALSRWGIPT
ITIPGTIDNDMMGTQYTLGFDTAVNTVLESVNKIRDTAFSHDRVAVIEVMGREAGFIALN
AGMASGAEAVLVPEHPVDLAALCRHLEESHRMKKLSSIVIVAEGAAKGADVVDYIKEHTY
LSPNLTVLGYVQRGGAPSAYDAIMAGRFAQKAVDSLLAGTYNCVVGLIDNRVVATPYSEA
EALRYPIDENLLSLVHLLGR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacaaaatcggagtattgaccagcggcggcgacgctcctggtatgaatgcggct
atccgcggggttacacggtatgccatccagaaaggtcttactgtcgaaggcatcattcgc
ggctatgaagggctgttgagtcatgaaacgcgccccttaggtcgtcgtgatgtcggcgct
atcatccatcgcggcggtacgatgcttcggacagcccgctgcctggaattcaaagaaaaa
gaaacgcagaaaaaagcagctgcctacctgcgtgaactggaaatagatgccctcgtcgtc
atcggcggcgacggttccatgcgcggtgcccaggctttgagccgctggggcatcccgacc
attaccattcccggcaccatcgacaacgatatgatggggacgcagtataccctgggtttc
gatacggctgtcaatacggttctggaatcggtcaataagattcgtgatacggcgttctcc
catgaccgcgtcgccgtcatcgaagtcatgggccgtgaagccggattcatcgccctcaat
gccggcatggcttccggtgccgaagcggtcctggtcccggaacatcctgtcgacttggct
gccctttgccgtcacctggaagaatcgcaccgcatgaagaaattgagcagtatcgtcatc
gtcgcggaaggcgctgccaaaggggccgatgtcgtcgactacatcaaagaacacacctac
ctttcgccgaacttgaccgtcctcggctatgtccagcgcggcggcgctccgtcggcttat
gacgccatcatggcaggccgttttgcccagaaagccgtcgacagcctgctggctggcacg
tacaactgtgtcgtcggcctcatcgataaccgcgtcgtagcgacgccgtattcggaagcc
gaagccctgcgctatcccatcgacgaaaatctgttgagcctggtccatctcttagggaga
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system