KEGG   Megasphaera elsdenii: MELS_1883Help
Entry
MELS_1883         CDS       T01633                                 

Definition
dTDP-4-dehydrorhamnose 3
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
med  Megasphaera elsdenii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:med00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:med00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2071509..2072117)
Genome map
AA seq 202 aa AA seqDB search
MGQIQVEKNVGGIDGLCVIMPTVHGDGRGYFMETYNQKDMEEAGFHINFVQDNQSMSTKG
VLRGLHFQKHFPQCKLVRAVRGSVFDVAVDLRRDSKTYGKWYGVELTEENKKQFLIPEGF
AHGFLVLSDVAEFCYKVNDFWHPNDEGGMAWNDPEIGIQWPQLVGEYKGSPSAAGYHLED
GTPLNLSDKDQQWLGLKDTFSF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagatacaggttgaaaagaatgtaggcggtattgatgggctttgtgtcattatg
ccgacggtccatggtgatggtcgtggatatttcatggaaacgtataatcagaaggatatg
gaagaagcgggattccatatcaattttgttcaggataatcagagcatgagcaccaaaggt
gtgcttcggggactccatttccagaagcatttccctcaatgcaaactcgtccgtgccgtc
cgcggcagtgtttttgacgtggctgtcgatttgcgccgtgattccaagacgtatggcaag
tggtatggcgtcgaattgacggaagaaaacaagaagcagttcctcattccggaaggcttt
gcccatggcttcctggtcctcagcgacgtagcggaattttgttataaggtcaacgacttc
tggcatcccaatgacgaaggcggcatggcctggaatgatccggaaatcggtatccagtgg
cctcagctcgtgggtgaatataaaggttcgcccagtgccgccggttatcatctcgaagac
gggacaccgttgaacctgagcgataaagaccagcagtggttggggttgaaagataccttt
tccttctga

DBGET integrated database retrieval system